Gene/Proteome Database (LMPD)
LMPD ID
LMP002033
Gene ID
Species
Mus musculus (Mouse)
Gene Name
fucosyltransferase 1
Gene Symbol
Synonyms
-
Chromosome
7
Map Location
7 B4|7 29.39 cM
Summary
This gene is one of three genes in mouse which encode a galactoside 2-L-fucosyltransferase. These genes differ in their developmental- and tissue-specific expression. The encoded type II membrane protein is anchored in the Golgi apparatus and controls the final step in the creation of alpha (1,2) fucosylated carbhohydrates by the addition of a terminal fucose in an alpha (1,2) linkage. This enzyme is required for the synthesis of the Lewis antigen as well as the H-antigen, a precursor of the A and B antigens of the ABH histo-blood group. The biological function of the fucosylated carbhohydrate products is thought to involve cell-adhesion and interactions with microorganisms. Disruption of this gene impairs development of the olfactory nerve and maturation of the glomerular layer of the main olfactory bulb. Alternative splicing results in multiple transcript variants which encode distinct isoforms. [provided by RefSeq, Dec 2012]
Orthologs
Proteins
| galactoside 2-alpha-L-fucosyltransferase 1 isoform 1 | |
|---|---|
| Refseq ID | NP_032077 |
| Protein GI | 49355810 |
| UniProt ID | P97327 |
| mRNA ID | NM_008051 |
| Length | 377 |
| RefSeq Status | REVIEWED |
| MWTPSRRQLCLAFLLVCVLSAGSFFFHLNGGNFFRNGLTLSVLCSDYHLLKSPVAMVCLPHPLQTSNGSPSCPEQSSSLSGTWTITPGGRFGNQMGQYATLLALAQLNGRQAFIQPEMHAALAPVFRISLPVLDPEVDSLTPWQHLVLHDWMSEEYSHLEDPFLKLSGFPCSWTFFHHLREQIRREFTLHNHLREGAQYLLSGLRIGPAGIRPHTFVGVHVRRGDYLEVMPNRWKGVVGDRAYLQQAMDWFRARHKDPIFVVTSNGMKWCLENIDTSHGDVVFAGNGQEGTPGKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFRPEAAFLPEWVGINADLSPLQAQFDPWKPDSLFRLV | |
| galactoside 2-alpha-L-fucosyltransferase 1 isoform 2 | |
|---|---|
| Refseq ID | NP_001258910 |
| Protein GI | 431822410 |
| UniProt ID | P97327 |
| mRNA ID | NM_001271981 |
| Length | 322 |
| RefSeq Status | REVIEWED |
| MVCLPHPLQTSNGSPSCPEQSSSLSGTWTITPGGRFGNQMGQYATLLALAQLNGRQAFIQPEMHAALAPVFRISLPVLDPEVDSLTPWQHLVLHDWMSEEYSHLEDPFLKLSGFPCSWTFFHHLREQIRREFTLHNHLREGAQYLLSGLRIGPAGIRPHTFVGVHVRRGDYLEVMPNRWKGVVGDRAYLQQAMDWFRARHKDPIFVVTSNGMKWCLENIDTSHGDVVFAGNGQEGTPGKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFRPEAAFLPEWVGINADLSPLQAQFDPWKPDSLFRLV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016020 | IEA:InterPro | C | membrane |
| GO:0008107 | IDA:MGI | F | galactoside 2-alpha-L-fucosyltransferase activity |
| GO:0036065 | IDA:MGI | P | fucosylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002516 | Glycosyl transferase, family 11 |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP002033 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 49355810 | RefSeq | NP_032077 | 377 | galactoside 2-alpha-L-fucosyltransferase 1 isoform 1 |
| 431822410 | RefSeq | NP_001258910 | 322 | galactoside 2-alpha-L-fucosyltransferase 1 isoform 2 |
Identical Sequences to LMP002033 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:49355810 | DBBJ | BAB68633.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus domesticus] |
| GI:49355810 | DBBJ | BAB68635.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus castaneus] |
| GI:49355810 | DBBJ | BAB68636.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus musculus] |
| GI:49355810 | DBBJ | BAE23444.1 | 377 | unnamed protein product [Mus musculus] |
| GI:431822410 | GenBank | AAI09147.1 | 322 | Fut1 protein [Mus musculus] |
| GI:431822410 | GenBank | AAI09146.1 | 322 | Fut1 protein [Mus musculus] |
| GI:49355810 | GenBank | EDL22877.1 | 377 | mCG23182 [Mus musculus] |
| GI:49355810 | RefSeq | XP_006540679.1 | 377 | PREDICTED: galactoside 2-alpha-L-fucosyltransferase 1 isoform X1 [Mus musculus] |
Related Sequences to LMP002033 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:431822410 | DBBJ | BAB68629.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus brevirostris] |
| GI:49355810 | DBBJ | BAB68630.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus musculus] |
| GI:431822410 | DBBJ | BAB68630.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus musculus] |
| GI:49355810 | DBBJ | BAB68631.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus castaneus] |
| GI:49355810 | DBBJ | BAB68632.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus molossinus] |
| GI:431822410 | DBBJ | BAB68632.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus molossinus] |
| GI:431822410 | DBBJ | BAB68633.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus domesticus] |
| GI:431822410 | DBBJ | BAB68634.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus molossinus] |
| GI:49355810 | DBBJ | BAB68634.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus musculus molossinus] |
| GI:49355810 | DBBJ | BAB68637.1 | 377 | beta-galactoside alpha-1,2-fucosyltransferase [Mus spicilegus] |
| GI:431822410 | GenBank | AAF45145.1 | 377 | alpha(1,2)fucosyltransferase FUT1 [Mus musculus] |
| GI:49355810 | GenBank | AAF45145.1 | 377 | alpha(1,2)fucosyltransferase FUT1 [Mus musculus] |