Gene/Proteome Database (LMPD)
Proteins
| COUP transcription factor 2 isoform 1 | |
|---|---|
| Refseq ID | NP_033827 |
| Protein GI | 45598394 |
| UniProt ID | Q3UST6 |
| mRNA ID | NM_009697 |
| Length | 414 |
| RefSeq Status | VALIDATED |
| MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ | |
| COUP transcription factor 2 isoform 2 | |
|---|---|
| Refseq ID | NP_899084 |
| Protein GI | 73611910 |
| UniProt ID | D3YYP4 |
| mRNA ID | NM_183261 |
| Length | 281 |
| RefSeq Status | VALIDATED |
| MQAVWDLEQGKYGFAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ | |
Gene Information
Entrez Gene ID
Gene Name
nuclear receptor subfamily 2, group F, member 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IDA:MGI | C | nucleus |
| GO:0003677 | IDA:MGI | F | DNA binding |
| GO:0004879 | IEA:InterPro | F | ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity |
| GO:0043565 | IDA:MGI | F | sequence-specific DNA binding |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0009952 | IMP:MGI | P | anterior/posterior pattern specification |
| GO:0048514 | IMP:MGI | P | blood vessel morphogenesis |
| GO:0009566 | IMP:MGI | P | fertilization |
| GO:0030900 | IDA:MGI | P | forebrain development |
| GO:0001701 | IMP:MGI | P | in utero embryonic development |
| GO:0060173 | IMP:MGI | P | limb development |
| GO:0001893 | IMP:MGI | P | maternal placenta development |
| GO:0000122 | IDA:MGI | P | negative regulation of transcription from RNA polymerase II promoter |
| GO:0001764 | IDA:MGI | P | neuron migration |
| GO:0060674 | IMP:MGI | P | placenta blood vessel development |
| GO:0009956 | IMP:MGI | P | radial pattern formation |
| GO:0006357 | IDA:MGI | P | regulation of transcription from RNA polymerase II promoter |
| GO:0007519 | IMP:MGI | P | skeletal muscle tissue development |
| GO:0060707 | IMP:MGI | P | trophoblast giant cell differentiation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
nuclear receptor subfamily 2, group F, member 2
Protein Entry
COT2_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP002034 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 45598394 | RefSeq | NP_033827 | 414 | COUP transcription factor 2 isoform 1 |
| 73611910 | RefSeq | NP_899084 | 281 | COUP transcription factor 2 isoform 2 |
Identical Sequences to LMP002034 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45598394 | GenBank | JAB22968.1 | 414 | COUP transcription factor 2 isoform a [Callithrix jacchus] |
| GI:45598394 | GenBank | JAB39973.1 | 414 | COUP transcription factor 2 isoform a [Callithrix jacchus] |
| GI:45598394 | GenBank | JAB39974.1 | 414 | COUP transcription factor 2 isoform a [Callithrix jacchus] |
| GI:45598394 | RefSeq | XP_005560624.1 | 414 | PREDICTED: COUP transcription factor 2 isoform X2 [Macaca fascicularis] |
| GI:45598394 | RefSeq | XP_006984478.1 | 414 | PREDICTED: COUP transcription factor 2-like [Peromyscus maniculatus bairdii] |
| GI:73611910 | RefSeq | XP_008685840.1 | 281 | PREDICTED: COUP transcription factor 2 [Ursus maritimus] |
| GI:73611910 | RefSeq | XP_008850566.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X2 [Nannospalax galili] |
| GI:73611910 | RefSeq | XP_008996594.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X2 [Callithrix jacchus] |
| GI:73611910 | RefSeq | XP_009209229.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X2 [Papio anubis] |
| GI:45598394 | RefSeq | XP_010359627.1 | 414 | PREDICTED: COUP transcription factor 2 isoform X1 [Rhinopithecus roxellana] |
| GI:73611910 | RefSeq | XP_010359628.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X2 [Rhinopithecus roxellana] |
| GI:73611910 | RefSeq | XP_010606175.1 | 281 | PREDICTED: COUP transcription factor 2 [Fukomys damarensis] |
Related Sequences to LMP002034 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45598394 | EMBL | CAB55624.1 | 414 | COUP-TFII transcription factor [Bos taurus] |
| GI:45598394 | GenBank | AAX29860.1 | 415 | nuclear receptor subfamily 2 group F member 2, partial [synthetic construct] |
| GI:45598394 | GenBank | AAI23678.1 | 414 | Nuclear receptor subfamily 2, group F, member 2 [Bos taurus] |
| GI:73611910 | GenBank | AAI34736.1 | 281 | NR2F2 protein [Bos taurus] |
| GI:45598394 | RefSeq | NP_776827.1 | 414 | COUP transcription factor 2 [Bos taurus] |
| GI:73611910 | RefSeq | XP_004617800.1 | 281 | PREDICTED: COUP transcription factor 2 [Sorex araneus] |
| GI:73611910 | RefSeq | XP_005221767.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X2 [Bos taurus] |
| GI:73611910 | RefSeq | XP_005869977.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X1 [Myotis brandtii] |
| GI:73611910 | RefSeq | XP_006044318.1 | 281 | PREDICTED: COUP transcription factor 2-like [Bubalus bubalis] |
| GI:73611910 | RefSeq | XP_008154686.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X1 [Eptesicus fuscus] |
| GI:45598394 | SwissProt | Q9TTR7.1 | 414 | RecName: Full=COUP transcription factor 2; Short=COUP-TF2; AltName: Full=COUP transcription factor II; Short=COUP-TF II; AltName: Full=Nuclear receptor subfamily 2 group F member 2 [Bos taurus] |
| GI:45598394 | Third Party Genbank | DAA17696.1 | 414 | TPA: COUP transcription factor 2 [Bos taurus] |