Gene/Proteome Database (LMPD)
LMPD ID
LMP002049
Gene ID
Species
Homo sapiens (Human)
Gene Name
phospholipase A2, group V
Gene Symbol
Synonyms
FRFB; GV-PLA2; PLA2-10; hVPLA(2)
Alternate Names
calcium-dependent phospholipase A2; Ca2+-dependent phospholipase A2; phosphatidylcholine 2-acylhydrolase 5
Chromosome
1
Map Location
1p36-p34
EC Number
3.1.1.4
Summary
This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholipids and free fatty acids including arachidonic acid. It preferentially hydrolyzes linoleoyl-containing phosphatidylcholine substrates. Secretion of this enzyme is thought to induce inflammatory responses in neighboring cells. Alternatively spliced transcript variants have been found, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
calcium-dependent phospholipase A2 precursor | |
---|---|
Refseq ID | NP_000920 |
Protein GI | 4505853 |
UniProt ID | P39877 |
mRNA ID | NM_000929 |
Length | 138 |
RefSeq Status | REVIEWED |
MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS | |
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2102 peptide sequence: MKGLLPLAWFLACSVPAVQG mat_peptide: 21..138 product: calcium-dependent phospholipase A2 calculated_mol_wt: 13591 peptide sequence: GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009986 | IEA:Ensembl | C | cell surface |
GO:0005576 | TAS:Reactome | C | extracellular region |
GO:0005794 | IEA:Ensembl | C | Golgi apparatus |
GO:0048471 | IEA:Ensembl | C | perinuclear region of cytoplasm |
GO:0005886 | IEA:Ensembl | C | plasma membrane |
GO:0047498 | TAS:ProtInc | F | calcium-dependent phospholipase A2 activity |
GO:0005509 | IEA:InterPro | F | calcium ion binding |
GO:0008201 | IEA:Ensembl | F | heparin binding |
GO:0050482 | IEA:Ensembl | P | arachidonic acid secretion |
GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
GO:0019370 | IEA:Ensembl | P | leukotriene biosynthetic process |
GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
GO:0006654 | TAS:Reactome | P | phosphatidic acid biosynthetic process |
GO:0036151 | TAS:Reactome | P | phosphatidylcholine acyl-chain remodeling |
GO:0036152 | TAS:Reactome | P | phosphatidylethanolamine acyl-chain remodeling |
GO:0036148 | TAS:Reactome | P | phosphatidylglycerol acyl-chain remodeling |
GO:0036149 | TAS:Reactome | P | phosphatidylinositol acyl-chain remodeling |
GO:0036150 | TAS:Reactome | P | phosphatidylserine acyl-chain remodeling |
GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
GO:0006663 | IEA:Ensembl | P | platelet activating factor biosynthetic process |
GO:0051591 | IEA:Ensembl | P | response to cAMP |
GO:0034097 | IEA:Ensembl | P | response to cytokine |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Biophysicochemical Properties | pH dependence: Optimum pH is 6.5. Activity remains high up to pH 9.0.; |
Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO |
Cofactor | Name=Ca(2+); Xref=ChEBI |
Disease | Fleck retina, familial benign (FRFB) [MIM |
Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L- alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L- alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle. |
Ptm | This enzyme lacks one of the seven disulfide bonds found in similar PA2 proteins. |
Similarity | Belongs to the phospholipase A2 family. |
Subcellular Location | Secreted. |
Tissue Specificity | Heart, placenta and less abundantly, in lung. Detected in the outer and inner plexiform layers of the retina (at protein level). |
Web Resource | Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/pla2g5/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP002049 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
4505853 | RefSeq | NP_000920 | 138 | calcium-dependent phospholipase A2 precursor |
Identical Sequences to LMP002049 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4505853 | GenBank | AIC49407.1 | 138 | PLA2G5, partial [synthetic construct] |
GI:4505853 | RefSeq | XP_006710755.1 | 138 | PREDICTED: calcium-dependent phospholipase A2 isoform X8 [Homo sapiens] |
GI:4505853 | RefSeq | XP_006710756.1 | 138 | PREDICTED: calcium-dependent phospholipase A2 isoform X9 [Homo sapiens] |
GI:4505853 | RefSeq | XP_006710757.1 | 138 | PREDICTED: calcium-dependent phospholipase A2 isoform X10 [Homo sapiens] |
GI:4505853 | RefSeq | XP_006710758.1 | 138 | PREDICTED: calcium-dependent phospholipase A2 isoform X11 [Homo sapiens] |
GI:4505853 | RefSeq | XP_006710759.1 | 138 | PREDICTED: calcium-dependent phospholipase A2 isoform X12 [Homo sapiens] |
Related Sequences to LMP002049 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4505853 | GenBank | EAW94913.1 | 169 | phospholipase A2, group V, isoform CRA_c [Homo sapiens] |
GI:4505853 | GenBank | ACM84808.1 | 182 | Sequence 10306 from patent US 6812339 |
GI:4505853 | RefSeq | XP_003814460.1 | 169 | PREDICTED: calcium-dependent phospholipase A2 isoform X1 [Pan paniscus] |
GI:4505853 | RefSeq | XP_005245948.1 | 169 | PREDICTED: calcium-dependent phospholipase A2 isoform X1 [Homo sapiens] |
GI:4505853 | RefSeq | XP_005245949.1 | 169 | PREDICTED: calcium-dependent phospholipase A2 isoform X2 [Homo sapiens] |
GI:4505853 | RefSeq | XP_006710754.1 | 169 | PREDICTED: calcium-dependent phospholipase A2 isoform X7 [Homo sapiens] |