Gene/Proteome Database (LMPD)

LMPD ID
LMP002055
Gene ID
Species
Mus musculus (Mouse)
Gene Name
cytochrome P450, family 21, subfamily a, polypeptide 1
Gene Symbol
Synonyms
21-OH; 21OH; 21OHA; 21OHB; CYP21OH-A; Cyp21; Cyp21-ps1; Cyp21B; Cyp21a2-ps; Cyp21a2ps; Oh21-1; Oh21-2
Alternate Names
steroid 21-hydroxylase; 21-OHase; 21-hydroxylase; cytochrome P-450; cytochrome P450 21; cytochrome P-450c21; cytochrome P450 XXI; cytochrome P450-C21; steroid 21 hydroxylase; cytochrome P450 hydroxylase A; cytochrome P450, 21, pseudogene; cytochrome P450, 21, steroid 21 hydroxylase; cytochrome P450, family 21, subfamily a, polypeptide 2, pseudogene
Chromosome
17
Map Location
17 B1|17 18.36 cM
EC Number
1.14.99.10

Proteins

steroid 21-hydroxylase precursor
Refseq ID NP_034125
Protein GI 160948604
UniProt ID P03940
mRNA ID NM_009995
Length 487
RefSeq Status VALIDATED
MLLPGLLLLLLLLAGTRWLWGQWKLRKLHLPPLAPGFLHFLQPNLPIYLLGLTQKLGPIYRIRLGMQDVVVLNSNRTIEEALIQKWVDFAGRPHMLNGKMDLDLSLGDYSLMWKAHKKLSRSALMLGMRDSMEPLIEQLTQEFCERMRAQAGTPVAIHKEFSFLTCSIISCLTFGDKDSTLVQTLHDCVQDLLQAWNHWSIQILTIIPLLRFLPNPGLQKLKQIQESRDHIVKQQLKRHKDSLVAGQWKDMIDYMLQGVEKQRDGKDEERLHEGHVHMSVVDLFIGGTETTATTLSWAVAFLLHHPEIQKRLQEELDLKLGPGSQLLYRNRMQLPLLMATIAEVLRLRPVVPLALPHRATRASSISGYDIPKDMVIIPNIQGANLDEMVWELPSKFWPDRFLEPGKNPRTPSFGCGARVCLGEPLARLELFVVLARLLQAFTLLPPPDGTLPSLQPQPYAGINLPIPPFQVRLQPRNLAPQDQGERP
sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2363 peptide sequence: MLLPGLLLLLLLLAGTRWLWG

Gene Information

Entrez Gene ID
Gene Name
cytochrome P450, family 21, subfamily a, polypeptide 1
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0004509 IEA:UniProtKB-EC F steroid 21-monooxygenase activity
GO:0005496 IEA:UniProtKB-KW F steroid binding
GO:0006694 IEA:UniProtKB-KW P steroid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 21, subfamily a, polypeptide 1
Protein Entry
CP21A_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity A C(21) steroid + (reduced NADPH--hemoprotein reductase) + O(2) = a 21-hydroxy-C(21)-steroid + (oxidized NADPH-- hemoprotein reductase) + H(2)O.
Cofactor Name=heme; Xref=ChEBI:CHEBI:30413; Evidence={ECO:0000250};
Domain The leucine-rich hydrophobic amino acid N-terminal region probably helps to anchor the protein to the microsomal membrane.
Function Specifically catalyzes the 21-hydroxylation of steroids. Required for the adrenal synthesis of mineralocorticoids and glucocorticoids.
Similarity Belongs to the cytochrome P450 family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP002055 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
160948604 RefSeq NP_034125 487 steroid 21-hydroxylase precursor

Identical Sequences to LMP002055 proteins

Reference Database Accession Length Protein Name
GI:160948604 GenBank AAC05278.1 487 cytochrome P450 hydroxylase A [Mus musculus]
GI:160948604 GenBank EDL26775.1 487 mCG134597 [Mus musculus]

Related Sequences to LMP002055 proteins

Reference Database Accession Length Protein Name
GI:160948604 DBBJ BAA31153.1 487 steroid 21-hydroxylase [Mus musculus]
GI:160948604 DBBJ BAE27263.1 487 unnamed protein product [Mus musculus]
GI:160948604 GenBank AAA37114.1 487 steroid 21 hydroxylase A [Mus musculus]
GI:160948604 GenBank AAA40118.1 487 cytochrome P-450 [Mus musculus]
GI:160948604 GenBank AAI27168.1 487 Cytochrome P450, family 21, subfamily a, polypeptide 1 [Mus musculus]
GI:160948604 SwissProt P03940.3 487 RecName: Full=Steroid 21-hydroxylase; AltName: Full=21-OHase; AltName: Full=Cytochrome P-450c21; AltName: Full=Cytochrome P450 21; AltName: Full=Cytochrome P450 XXI; AltName: Full=Cytochrome P450-C21 [Mus musculus]