Gene/Proteome Database (LMPD)
LMPD ID
LMP002055
Gene ID
Species
Mus musculus (Mouse)
Gene Name
cytochrome P450, family 21, subfamily a, polypeptide 1
Gene Symbol
Synonyms
21-OH; 21OH; 21OHA; 21OHB; CYP21OH-A; Cyp21; Cyp21-ps1; Cyp21B; Cyp21a2-ps; Cyp21a2ps; Oh21-1; Oh21-2
Alternate Names
steroid 21-hydroxylase; 21-OHase; 21-hydroxylase; cytochrome P-450; cytochrome P450 21; cytochrome P-450c21; cytochrome P450 XXI; cytochrome P450-C21; steroid 21 hydroxylase; cytochrome P450 hydroxylase A; cytochrome P450, 21, pseudogene; cytochrome P450, 21, steroid 21 hydroxylase; cytochrome P450, family 21, subfamily a, polypeptide 2, pseudogene
Chromosome
17
Map Location
17 B1|17 18.36 cM
EC Number
1.14.99.10
Proteins
| steroid 21-hydroxylase precursor | |
|---|---|
| Refseq ID | NP_034125 |
| Protein GI | 160948604 |
| UniProt ID | P03940 |
| mRNA ID | NM_009995 |
| Length | 487 |
| RefSeq Status | VALIDATED |
| MLLPGLLLLLLLLAGTRWLWGQWKLRKLHLPPLAPGFLHFLQPNLPIYLLGLTQKLGPIYRIRLGMQDVVVLNSNRTIEEALIQKWVDFAGRPHMLNGKMDLDLSLGDYSLMWKAHKKLSRSALMLGMRDSMEPLIEQLTQEFCERMRAQAGTPVAIHKEFSFLTCSIISCLTFGDKDSTLVQTLHDCVQDLLQAWNHWSIQILTIIPLLRFLPNPGLQKLKQIQESRDHIVKQQLKRHKDSLVAGQWKDMIDYMLQGVEKQRDGKDEERLHEGHVHMSVVDLFIGGTETTATTLSWAVAFLLHHPEIQKRLQEELDLKLGPGSQLLYRNRMQLPLLMATIAEVLRLRPVVPLALPHRATRASSISGYDIPKDMVIIPNIQGANLDEMVWELPSKFWPDRFLEPGKNPRTPSFGCGARVCLGEPLARLELFVVLARLLQAFTLLPPPDGTLPSLQPQPYAGINLPIPPFQVRLQPRNLAPQDQGERP | |
| sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2363 peptide sequence: MLLPGLLLLLLLLAGTRWLWG | |
Gene Information
Entrez Gene ID
Gene Name
cytochrome P450, family 21, subfamily a, polypeptide 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016020 | IEA:UniProtKB-KW | C | membrane |
| GO:0020037 | IEA:InterPro | F | heme binding |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0004509 | IEA:UniProtKB-EC | F | steroid 21-monooxygenase activity |
| GO:0005496 | IEA:UniProtKB-KW | F | steroid binding |
| GO:0006694 | IEA:UniProtKB-KW | P | steroid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu00140 | Steroid hormone biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cytochrome P450, family 21, subfamily a, polypeptide 1
Protein Entry
CP21A_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A C(21) steroid + (reduced NADPH--hemoprotein reductase) + O(2) = a 21-hydroxy-C(21)-steroid + (oxidized NADPH-- hemoprotein reductase) + H(2)O. |
| Cofactor | Name=heme; Xref=ChEBI:CHEBI:30413; Evidence={ECO:0000250}; |
| Domain | The leucine-rich hydrophobic amino acid N-terminal region probably helps to anchor the protein to the microsomal membrane. |
| Function | Specifically catalyzes the 21-hydroxylation of steroids. Required for the adrenal synthesis of mineralocorticoids and glucocorticoids. |
| Similarity | Belongs to the cytochrome P450 family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002055 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 160948604 | RefSeq | NP_034125 | 487 | steroid 21-hydroxylase precursor |
Identical Sequences to LMP002055 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:160948604 | GenBank | AAC05278.1 | 487 | cytochrome P450 hydroxylase A [Mus musculus] |
| GI:160948604 | GenBank | EDL26775.1 | 487 | mCG134597 [Mus musculus] |
Related Sequences to LMP002055 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:160948604 | DBBJ | BAA31153.1 | 487 | steroid 21-hydroxylase [Mus musculus] |
| GI:160948604 | DBBJ | BAE27263.1 | 487 | unnamed protein product [Mus musculus] |
| GI:160948604 | GenBank | AAA37114.1 | 487 | steroid 21 hydroxylase A [Mus musculus] |
| GI:160948604 | GenBank | AAA40118.1 | 487 | cytochrome P-450 [Mus musculus] |
| GI:160948604 | GenBank | AAI27168.1 | 487 | Cytochrome P450, family 21, subfamily a, polypeptide 1 [Mus musculus] |
| GI:160948604 | SwissProt | P03940.3 | 487 | RecName: Full=Steroid 21-hydroxylase; AltName: Full=21-OHase; AltName: Full=Cytochrome P-450c21; AltName: Full=Cytochrome P450 21; AltName: Full=Cytochrome P450 XXI; AltName: Full=Cytochrome P450-C21 [Mus musculus] |