Gene/Proteome Database (LMPD)

LMPD ID
LMP002113
Gene ID
102193
Species
Mus musculus (Mouse)
Gene Name
zinc finger, DHHC domain containing 7
Gene Symbol
Zdhhc7
Synonyms
AL024087; Gramp2
Alternate Names
palmitoyltransferase ZDHHC7; DHHC-7; zinc finger DHHC domain-containing protein 7; GABA-A receptor-associated membrane protein 2
Chromosome
8
Map Location
8 E1|8
EC Number
2.3.1.225

Proteins

palmitoyltransferase ZDHHC7
Refseq ID NP_598728
Protein GI 19527186
UniProt ID Q91WU6
mRNA ID NM_133967
Length 308
RefSeq Status PROVISIONAL
MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSETDMADRVWFIRDGCGMVCAVMTWLLVVYADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRLRRLQMRTRKGGPEFSV

Gene Information

Entrez Gene ID
102193
Gene Name
zinc finger, DHHC domain containing 7
Gene Symbol
Zdhhc7
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 ISS:UniProtKB C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016409 IDA:MGI F palmitoyltransferase activity
GO:0019706 IEA:UniProtKB-EC F protein-cysteine S-palmitoyltransferase activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0018230 ISS:UniProtKB P peptidyl-L-cysteine S-palmitoylation
GO:0018345 IDA:MGI P protein palmitoylation

Domain Information

InterPro Annotations

Accession Description
IPR001594 Zinc finger, DHHC-type, palmitoyltransferase

UniProt Annotations

Entry Information

Gene Name
zinc finger, DHHC domain containing 7
Protein Entry
ZDHC7_MOUSE
UniProt ID
Q91WU6
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
Domain The DHHC domain is required for palmitoyltransferase activity.
Function Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane. This affects rapid intracellular signaling by sex hormones via ERK and AKT kinases and the generation of cAMP, but does not affect that mediated by their nuclear receptors (By similarity). Palmitoyltransferase with broad specificity. Palmitoylates SNAP25 and DLG4/PSD95. May palmitoylate GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3) and regulate their synaptic clustering and/or cell surface stability. {ECO:0000250, ECO:0000269|PubMed:15229235, ECO:0000269|PubMed:15603741}.
Similarity Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}.
Similarity Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. Golgi apparatus {ECO:0000250}.
Tissue Specificity Ubiquitously expressed, with highest levels in liver, kidney and brain. Expressed in all brain regions. {ECO:0000269|PubMed:15603741}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002113 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
19527186 RefSeq NP_598728 308 palmitoyltransferase ZDHHC7

Identical Sequences to LMP002113 proteins

Reference Database Accession Length Protein Name
GI:19527186 DBBJ BAE34289.1 308 unnamed protein product [Mus musculus]
GI:19527186 DBBJ BAE43018.1 308 unnamed protein product [Mus musculus]
GI:19527186 DBBJ BAE41929.1 308 unnamed protein product [Mus musculus]
GI:19527186 GenBank AAO27360.1 308 GABA-A receptor-associated membrane protein 2 [Mus musculus]
GI:19527186 GenBank AAH75666.1 308 Zinc finger, DHHC domain containing 7 [Mus musculus]
GI:19527186 GenBank EDL11627.1 308 zinc finger, DHHC domain containing 7, isoform CRA_b [Mus musculus]

Related Sequences to LMP002113 proteins

Reference Database Accession Length Protein Name
GI:19527186 DBBJ BAE42116.1 308 unnamed protein product [Mus musculus]
GI:19527186 GenBank AAH61769.1 308 Zinc finger, DHHC-type containing 7 [Rattus norvegicus]
GI:19527186 GenBank AAX73387.1 308 membrane-associated DHHC7 zinc finger protein [Rattus norvegicus]
GI:19527186 GenBank EDL11626.1 357 zinc finger, DHHC domain containing 7, isoform CRA_a [Mus musculus]
GI:19527186 GenBank EDL92694.1 308 zinc finger, DHHC domain containing 7, isoform CRA_b [Rattus norvegicus]
GI:19527186 RefSeq NP_596885.1 308 palmitoyltransferase ZDHHC7 [Rattus norvegicus]