Gene/Proteome Database (LMPD)
LMPD ID
LMP002113
Gene ID
Species
Mus musculus (Mouse)
Gene Name
zinc finger, DHHC domain containing 7
Gene Symbol
Synonyms
AL024087; Gramp2
Alternate Names
palmitoyltransferase ZDHHC7; DHHC-7; zinc finger DHHC domain-containing protein 7; GABA-A receptor-associated membrane protein 2
Chromosome
8
Map Location
8 E1|8
EC Number
2.3.1.225
Proteins
| palmitoyltransferase ZDHHC7 | |
|---|---|
| Refseq ID | NP_598728 |
| Protein GI | 19527186 |
| UniProt ID | Q91WU6 |
| mRNA ID | NM_133967 |
| Length | 308 |
| RefSeq Status | PROVISIONAL |
| MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSETDMADRVWFIRDGCGMVCAVMTWLLVVYADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRLRRLQMRTRKGGPEFSV | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC domain containing 7
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | ISS:UniProtKB | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016409 | IDA:MGI | F | palmitoyltransferase activity |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0018230 | ISS:UniProtKB | P | peptidyl-L-cysteine S-palmitoylation |
| GO:0018345 | IDA:MGI | P | protein palmitoylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC domain containing 7
Protein Entry
ZDHC7_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Function | Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane. This affects rapid intracellular signaling by sex hormones via ERK and AKT kinases and the generation of cAMP, but does not affect that mediated by their nuclear receptors (By similarity). Palmitoyltransferase with broad specificity. Palmitoylates SNAP25 and DLG4/PSD95. May palmitoylate GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3) and regulate their synaptic clustering and/or cell surface stability. {ECO:0000250, ECO:0000269|PubMed:15229235, ECO:0000269|PubMed:15603741}. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}. |
| Similarity | Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. Golgi apparatus {ECO:0000250}. |
| Tissue Specificity | Ubiquitously expressed, with highest levels in liver, kidney and brain. Expressed in all brain regions. {ECO:0000269|PubMed:15603741}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002113 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 19527186 | RefSeq | NP_598728 | 308 | palmitoyltransferase ZDHHC7 |
Identical Sequences to LMP002113 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19527186 | DBBJ | BAE34289.1 | 308 | unnamed protein product [Mus musculus] |
| GI:19527186 | DBBJ | BAE43018.1 | 308 | unnamed protein product [Mus musculus] |
| GI:19527186 | DBBJ | BAE41929.1 | 308 | unnamed protein product [Mus musculus] |
| GI:19527186 | GenBank | AAO27360.1 | 308 | GABA-A receptor-associated membrane protein 2 [Mus musculus] |
| GI:19527186 | GenBank | AAH75666.1 | 308 | Zinc finger, DHHC domain containing 7 [Mus musculus] |
| GI:19527186 | GenBank | EDL11627.1 | 308 | zinc finger, DHHC domain containing 7, isoform CRA_b [Mus musculus] |
Related Sequences to LMP002113 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19527186 | DBBJ | BAE42116.1 | 308 | unnamed protein product [Mus musculus] |
| GI:19527186 | GenBank | AAH61769.1 | 308 | Zinc finger, DHHC-type containing 7 [Rattus norvegicus] |
| GI:19527186 | GenBank | AAX73387.1 | 308 | membrane-associated DHHC7 zinc finger protein [Rattus norvegicus] |
| GI:19527186 | GenBank | EDL11626.1 | 357 | zinc finger, DHHC domain containing 7, isoform CRA_a [Mus musculus] |
| GI:19527186 | GenBank | EDL92694.1 | 308 | zinc finger, DHHC domain containing 7, isoform CRA_b [Rattus norvegicus] |
| GI:19527186 | RefSeq | NP_596885.1 | 308 | palmitoyltransferase ZDHHC7 [Rattus norvegicus] |