Gene/Proteome Database (LMPD)

LMPD ID
LMP002114
Gene ID
8760
Species
Homo sapiens (Human)
Gene Name
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Gene Symbol
CDS2
Synonyms
-
Alternate Names
phosphatidate cytidylyltransferase 2; CDS 2; CDP-DG synthase 2; CDP-DAG synthase 2; CDP-DG synthetase 2; CDP-diglyceride synthase 2; CDP-diglyceride synthetase 2; CDP-diacylglycerol synthase 2; CDP-diglyceride diphosphorylase 2; CDP-diglyceride pyrophosphorylase 2; CTP:phosphatidate cytidylyltransferase 2
Chromosome
20
Map Location
20p13
EC Number
2.7.7.41
Summary
Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for CDS2

Proteins

phosphatidate cytidylyltransferase 2
Refseq ID NP_003809
Protein GI 20143480
UniProt ID O95674
mRNA ID NM_003818
Length 445
RefSeq Status REVIEWED
MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGMLTSTTEDE

Gene Information

Entrez Gene ID
8760
Gene Name
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Gene Symbol
CDS2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 IDA:UniProtKB C membrane
GO:0005743 TAS:Reactome C mitochondrial inner membrane
GO:0004605 NAS:UniProtKB F phosphatidate cytidylyltransferase activity
GO:0016024 IEA:UniProtKB-UniPathway P CDP-diacylglycerol biosynthetic process
GO:0046474 TAS:Reactome P glycerophospholipid biosynthetic process
GO:0006655 TAS:Reactome P phosphatidylglycerol biosynthetic process
GO:0006644 TAS:Reactome P phospholipid metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00564 Glycerophospholipid metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5667 CDP-diacylglycerol biosynthesis I

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_121401 Glycerophospholipid biosynthesis
REACT_121280 Synthesis of PG

Domain Information

InterPro Annotations

Accession Description
IPR000374 Phosphatidate cytidylyltransferase
IPR016720 Phosphatidate cytidylyltransferase, eukaryota

UniProt Annotations

Entry Information

Gene Name
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Protein Entry
CDS2_HUMAN
UniProt ID
O95674
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O95674-1; Sequence=Displayed; Name=2; IsoId=O95674-2; Sequence=VSP_015477, VSP_015480, VSP_015482; Note=No experimental confirmation available.;
Catalytic Activity CTP + phosphatidate = diphosphate + CDP- diacylglycerol.
Developmental Stage No expression detected at E10.5 in the developing brain. At E12.5 expression is detected in the developing sentral nervous system and peripheral nervous system. At E17.5 high levels of expression are detected in a number of sites, including the dorsal root ganglia of the peripheral nervous system and the ganglion cell layer of the neural retina in the developing eye. At this stage expression in the brain is restricted to the ventricular zone of the telencephalon, in particular in the basal ganglia and the cerebral cortex.
Function Provides CDP-diacylglycerol, an important precursor for the synthesis of phosphatidylinositol, phosphatidylglycerol, and cardiolipin.
Pathway Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 3/3.
Similarity Belongs to the CDS family.
Subcellular Location Mitochondrion inner membrane ; Multi-pass membrane protein ; Matrix side .
Tissue Specificity Widely expressed. Expressed in heart, brain and retina, and to a lesser extent in placenta, lung, liver, skeletal muscle, kidney and pancreas.

Identical and Related Proteins

Unique RefSeq proteins for LMP002114 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20143480 RefSeq NP_003809 445 phosphatidate cytidylyltransferase 2

Identical Sequences to LMP002114 proteins

Reference Database Accession Length Protein Name
GI:20143480 DBBJ BAG37873.1 445 unnamed protein product [Homo sapiens]
GI:20143480 DBBJ BAI47230.1 445 CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2, partial [synthetic construct]
GI:20143480 GenBank EAX10426.1 445 CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2, isoform CRA_a [Homo sapiens]
GI:20143480 GenBank ABM82569.1 445 CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [synthetic construct]
GI:20143480 GenBank ABM85758.1 445 CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2, partial [synthetic construct]
GI:20143480 GenBank AIC50199.1 445 CDS2, partial [synthetic construct]

Related Sequences to LMP002114 proteins

Reference Database Accession Length Protein Name
GI:20143480 DBBJ BAG51366.1 445 unnamed protein product [Homo sapiens]
GI:20143480 EMBL CAE89391.1 445 unnamed protein product [Homo sapiens]
GI:20143480 EMBL CAE89644.1 445 unnamed protein product [Homo sapiens]
GI:20143480 GenBank AAO96510.1 445 Sequence 12 from patent US 6503700
GI:20143480 RefSeq XP_004061822.1 445 PREDICTED: phosphatidate cytidylyltransferase 2 [Gorilla gorilla gorilla]
GI:20143480 RefSeq XP_008017120.1 445 PREDICTED: phosphatidate cytidylyltransferase 2 [Chlorocebus sabaeus]