Gene/Proteome Database (LMPD)
Proteins
| group IID secretory phospholipase A2 precursor | |
|---|---|
| Refseq ID | NP_035239 |
| Protein GI | 7242177 |
| UniProt ID | Q3TYT9 |
| mRNA ID | NM_011109 |
| Length | 144 |
| RefSeq Status | PROVISIONAL |
| MRLALLCGLLLAGITATQGGLLNLNKMVTHMTGKKAFFSYWPYGCHCGLGGKGQPKDATDWCCQKHDCCYAHLKIDGCKSLTDNYKYSISQGTIQCSDNGSWCERQLCACDKEVALCLKQNLDSYNKRLRYYWRPRCKGKTPAC | |
| sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1915 peptide sequence: MRLALLCGLLLAGITATQG mat_peptide: 20..144 product: Group IID secretory phospholipase A2 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9WVF6.1) calculated_mol_wt: 14267 peptide sequence: GLLNLNKMVTHMTGKKAFFSYWPYGCHCGLGGKGQPKDATDWCCQKHDCCYAHLKIDGCKSLTDNYKYSISQGTIQCSDNGSWCERQLCACDKEVALCLKQNLDSYNKRLRYYWRPRCKGKTPAC | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0004623 | IEA:InterPro | F | phospholipase A2 activity |
| GO:0016042 | IEA:InterPro | P | lipid catabolic process |
| GO:0006644 | IEA:InterPro | P | phospholipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. |
| Cofactor | Note=Binds 1 calcium ion per subunit. ; |
| Similarity | Belongs to the phospholipase A2 family. |
| Subcellular Location | Secreted . |
Identical and Related Proteins
Unique RefSeq proteins for LMP002148 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 7242177 | RefSeq | NP_035239 | 144 | group IID secretory phospholipase A2 precursor |
Identical Sequences to LMP002148 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7242177 | DBBJ | BAE34473.1 | 144 | unnamed protein product [Mus musculus] |
| GI:7242177 | DBBJ | BAE34077.1 | 144 | unnamed protein product [Mus musculus] |
| GI:7242177 | GenBank | ABC14772.1 | 144 | Sequence 14 from patent US 6967095 |
| GI:7242177 | GenBank | AAI11807.1 | 144 | Pla2g2d protein [Mus musculus] |
| GI:7242177 | GenBank | EDL13278.1 | 144 | phospholipase A2, group IID, isoform CRA_b [Mus musculus] |
| GI:7242177 | GenBank | AEU43343.1 | 144 | Sequence 92 from patent US 8052970 |
Related Sequences to LMP002148 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7242177 | DBBJ | BAE43166.1 | 118 | unnamed protein product [Mus musculus] |
| GI:7242177 | DBBJ | BAE42967.1 | 144 | unnamed protein product [Mus musculus] |
| GI:7242177 | GenBank | AAH91221.1 | 144 | Phospholipase A2, group IID [Rattus norvegicus] |
| GI:7242177 | RefSeq | NP_001013446.1 | 144 | group IID secretory phospholipase A2 precursor [Rattus norvegicus] |
| GI:7242177 | RefSeq | XP_005081102.1 | 145 | PREDICTED: group IID secretory phospholipase A2 [Mesocricetus auratus] |
| GI:7242177 | RefSeq | XP_006980960.1 | 145 | PREDICTED: group IID secretory phospholipase A2 [Peromyscus maniculatus bairdii] |