Gene/Proteome Database (LMPD)

LMPD ID
LMP002178
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phytanoyl-CoA hydroxylase
Gene Symbol
Synonyms
AI256161; AI265699; Lnap1; PAHX
Alternate Names
phytanoyl-CoA dioxygenase, peroxisomal; phytanic acid oxidase; phytanoyl-CoA alpha-hydroxylase; lupus nephritis-associated peptide 1
Chromosome
2
Map Location
2 A1|2
EC Number
1.14.11.18

Proteins

phytanoyl-CoA dioxygenase, peroxisomal precursor
Refseq ID NP_034856
Protein GI 6754564
UniProt ID O35386
mRNA ID NM_010726
Length 338
RefSeq Status VALIDATED
MNLTRAGARLQVLLGHLGRPSAPTIVAQPVSGLASPASFQPEQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVSDDDIQRFRAEFERICREEVKPPGIVIMRDVALAKQDYMPSDRMVSKIQDFQEDEELFRYCLLPEILKYVECFTGPNIMALHGMLINKPPDVGKKTSRHPLHQDLHYFPFRPSNLIVCAWTAMEHIDRNNGCLVVLPGTHKGTLKPHDYPKWEGGVNKMYHGIQDYDPNSPRVHLVMEKGDTVFFHPLLIHGSGRNKTQGFRKAISCHFGSSDCQCIDVSGTSQENIAREVVEMAEKKYGFQGVMDFKDTWIFRSRLVKGERINI
transit_peptide: 1..30 inference: non-experimental evidence, no additional details recorded note: Peroxisome (By similarity); propagated from UniProtKB/Swiss-Prot (O35386.1) calculated_mol_wt: 3138 peptide sequence: MNLTRAGARLQVLLGHLGRPSAPTIVAQPV mat_peptide: 31..338 product: Phytanoyl-CoA dioxygenase, peroxisomal experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (O35386.1) calculated_mol_wt: 35488 peptide sequence: SGLASPASFQPEQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVSDDDIQRFRAEFERICREEVKPPGIVIMRDVALAKQDYMPSDRMVSKIQDFQEDEELFRYCLLPEILKYVECFTGPNIMALHGMLINKPPDVGKKTSRHPLHQDLHYFPFRPSNLIVCAWTAMEHIDRNNGCLVVLPGTHKGTLKPHDYPKWEGGVNKMYHGIQDYDPNSPRVHLVMEKGDTVFFHPLLIHGSGRNKTQGFRKAISCHFGSSDCQCIDVSGTSQENIAREVVEMAEKKYGFQGVMDFKDTWIFRSRLVKGERINI

Gene Information

Entrez Gene ID
Gene Name
phytanoyl-CoA hydroxylase
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IDA:MGI C mitochondrion
GO:0005777 TAS:MGI C peroxisome
GO:0031418 IEA:UniProtKB-KW F L-ascorbic acid binding
GO:0003824 IDA:MGI F catalytic activity
GO:0048037 IEA:Ensembl F cofactor binding
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0048244 IEA:UniProtKB-EC F phytanoyl-CoA dioxygenase activity
GO:0001561 IDA:MGI P fatty acid alpha-oxidation
GO:0006720 IEA:Ensembl P isoprenoid metabolic process
GO:0097089 IEA:Ensembl P methyl-branched fatty acid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko04146 Peroxisome
mmu04146 Peroxisome

REACTOME Pathway Links

REACTOME Pathway ID Description
5893690 Alpha-oxidation of phytanate
5892980 Peroxisomal lipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR008775 Phytanoyl-CoA dioxygenase

UniProt Annotations

Entry Information

Gene Name
phytanoyl-CoA hydroxylase
Protein Entry
PAHX_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Phytanoyl-CoA + 2-oxoglutarate + O(2) = 2- hydroxyphytanoyl-CoA + succinate + CO(2).
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875;
Cofactor Name=L-ascorbate; Xref=ChEBI:CHEBI:38290;
Disease Note=Defects in Phyh are the cause of lupus nephritis, a severe autoimmune disease. Phyh could be involved in a reaction against the progression of the disease, because its expression is low in the early stage of the disease in the renal cortex of MRL/lpr mice.
Function Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.
Pathway Lipid metabolism; fatty acid metabolism.
Similarity Belongs to the PhyH family. {ECO:0000305}.
Subcellular Location Peroxisome.
Subunit Interacts specifically with the immunophilin FKBP52 and PHYHIP. {ECO:0000269|PubMed:10686344}.
Tissue Specificity Ubiquitously expressed in all tissues with significant levels detected in the embryonic and neonatal heart and liver. In the adult, significant levels are detected in the liver, kidney, heart, gut, brain and aorta. {ECO:0000269|PubMed:10686344}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002178 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6754564 RefSeq NP_034856 338 phytanoyl-CoA dioxygenase, peroxisomal precursor

Identical Sequences to LMP002178 proteins

Reference Database Accession Length Protein Name
GI:6754564 DBBJ BAE40985.1 338 unnamed protein product [Mus musculus]
GI:6754564 DBBJ BAE27410.1 338 unnamed protein product [Mus musculus]
GI:6754564 DBBJ BAE37810.1 338 unnamed protein product [Mus musculus]
GI:6754564 DBBJ BAE38170.1 338 unnamed protein product [Mus musculus]
GI:6754564 GenBank AAH02018.1 338 Phytanoyl-CoA hydroxylase [Mus musculus]
GI:6754564 GenBank EDL07951.1 338 phytanoyl-CoA hydroxylase, isoform CRA_a [Mus musculus]

Related Sequences to LMP002178 proteins

Reference Database Accession Length Protein Name
GI:6754564 DBBJ BAA19003.1 338 LN1 [Mus musculus]
GI:6754564 DBBJ BAE40505.1 338 unnamed protein product [Mus musculus]
GI:6754564 GenBank AAF15971.1 338 peroxisomal phytanoyl-CoA hydroxylase [Rattus norvegicus]
GI:6754564 GenBank AAH86573.1 338 Phytanoyl-CoA 2-hydroxylase [Rattus norvegicus]
GI:6754564 GenBank EDL78672.1 338 phytanoyl-CoA hydroxylase, isoform CRA_a [Rattus norvegicus]
GI:6754564 RefSeq NP_446126.1 338 phytanoyl-CoA dioxygenase, peroxisomal precursor [Rattus norvegicus]