Gene/Proteome Database (LMPD)
LMPD ID
LMP002181
Gene ID
Species
Mus musculus (Mouse)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 7
Gene Symbol
Synonyms
AI266814; ERG27
Alternate Names
3-keto-steroid reductase; 17-beta-HSD 7; estradiol 17-beta-dehydrogenase 7; 17-beta-hydroxysteroid dehydrogenase 7
Chromosome
1
Map Location
1 H3|1
EC Number
1.1.1.270
Proteins
| 3-keto-steroid reductase | |
|---|---|
| Refseq ID | NP_034606 |
| Protein GI | 87162470 |
| UniProt ID | O88736 |
| mRNA ID | NM_010476 |
| Length | 334 |
| RefSeq Status | VALIDATED |
| MRKVVLITGASSGIGLALCGRLLAEDDDLHLCLACRNLSKARAVRDTLLASHPSAEVSIVQMDVSSLQSVVRGAEEVKQKFQRLDYLYLNAGILPNPQFNLKAFFCGIFSRNVIHMFTTAEGILTQNDSVTADGLQEVFETNLFGHFILIRELEPLLCHADNPSQLIWTSSRNAKKANFSLEDIQHSKGPEPYSSSKYATDLLNVALNRNFNQKGLYSSVMCPGVVMTNMTYGILPPFIWTLLLPIMWLLRFFVNALTVTPYNGAEALVWLFHQKPESLNPLTKYASATSGFGTNYVTGQKMDIDEDTAEKFYEVLLELEKRVRTTVQKSDHPS | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 7
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:MGI | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0000253 | IDA:MGI | F | 3-keto sterol reductase activity |
| GO:0004303 | IEA:UniProtKB-EC | F | estradiol 17-beta-dehydrogenase activity |
| GO:0006695 | IDA:MGI | P | cholesterol biosynthetic process |
| GO:0006703 | IEA:UniProtKB-UniPathway | P | estrogen biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 7
Protein Entry
DHB7_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H. |
| Catalytic Activity | A 3-beta-hydroxysteroid + NADP(+) = a 3- oxosteroid + NADPH. |
| Function | Responsible for the reduction of the keto group on the C-3 of sterols. |
| Pathway | Steroid biosynthesis; estrogen biosynthesis. |
| Pathway | Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 5/6. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. ERG27 subfamily. {ECO:0000305}. |
| Subcellular Location | Cell membrane; Single-pass membrane protein. |
| Tissue Specificity | Most abundant in ovaries of pregnant animals. Present also in nonpregnant animals in ovaries, mammary gland, liver, kidney and testis. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002181 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 87162470 | RefSeq | NP_034606 | 334 | 3-keto-steroid reductase |
Identical Sequences to LMP002181 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:87162470 | DBBJ | BAC34124.1 | 334 | unnamed protein product [Mus musculus] |
| GI:87162470 | DBBJ | BAC25918.1 | 334 | unnamed protein product [Mus musculus] |
| GI:87162470 | EMBL | CAA75742.1 | 334 | 17-beta-hydroxysteroid dehydrogenase type 7 [Mus musculus] |
| GI:87162470 | GenBank | ABI05591.1 | 334 | Sequence 32 from patent US 7078169 |
| GI:87162470 | GenBank | AEW41340.1 | 334 | Sequence 4 from patent US 8076102 |
| GI:87162470 | SwissProt | O88736.1 | 334 | RecName: Full=3-keto-steroid reductase; AltName: Full=17-beta-hydroxysteroid dehydrogenase 7; Short=17-beta-HSD 7; AltName: Full=Estradiol 17-beta-dehydrogenase 7 [Mus musculus] |
Related Sequences to LMP002181 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:87162470 | EMBL | CAC88119.1 | 334 | 17beta-hydroxysteroid dehydrogenase type 7 [Mus musculus] |
| GI:87162470 | GenBank | ABI05597.1 | 334 | Sequence 43 from patent US 7078169 |
| GI:87162470 | GenBank | EDL39168.1 | 334 | hydroxysteroid (17-beta) dehydrogenase 7, isoform CRA_b [Mus musculus] |
| GI:87162470 | RefSeq | NP_058931.1 | 334 | 3-keto-steroid reductase [Rattus norvegicus] |
| GI:87162470 | RefSeq | XP_006496730.1 | 315 | PREDICTED: 3-keto-steroid reductase isoform X1 [Mus musculus] |
| GI:87162470 | SwissProt | Q62904.1 | 334 | RecName: Full=3-keto-steroid reductase; AltName: Full=17-beta-hydroxysteroid dehydrogenase 7; Short=17-beta-HSD 7; AltName: Full=Estradiol 17-beta-dehydrogenase 7; AltName: Full=PRL receptor-associated protein; Short=PRAP [Rattus norvegicus] |