Gene/Proteome Database (LMPD)
LMPD ID
LMP002208
Gene ID
Species
Homo sapiens (Human)
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Gene Symbol
Synonyms
-
Alternate Names
5'-AMP-activated protein kinase subunit beta-2;,AMPK beta 2; AMPK beta-2 chain; AMPK subunit beta-2', "5'-AMP-activated protein kinase, beta-2 subunit;,AMP-activated protein kinase beta 2 non-catalytic subunit
Chromosome
1
Map Location
1q21.1
Summary
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2013]
Orthologs
Proteins
| 5'-AMP-activated protein kinase subunit beta-2 | |
|---|---|
| Refseq ID | NP_005390 |
| Protein GI | 4885561 |
| UniProt ID | O43741 |
| mRNA ID | NM_005399 |
| Length | 272 |
| RefSeq Status | REVIEWED |
| MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI | |
Gene Information
Entrez Gene ID
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031588 | IDA:UniProtKB | C | AMP-activated protein kinase complex |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0005654 | TAS:Reactome | C | nucleoplasm |
| GO:0042802 | IPI:IntAct | F | identical protein binding |
| GO:0006853 | TAS:Reactome | P | carnitine shuttle |
| GO:0007050 | TAS:Reactome | P | cell cycle arrest |
| GO:0044255 | TAS:Reactome | P | cellular lipid metabolic process |
| GO:0006112 | TAS:Reactome | P | energy reserve metabolic process |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
| GO:0008286 | TAS:Reactome | P | insulin receptor signaling pathway |
| GO:0061024 | TAS:Reactome | P | membrane organization |
| GO:0006468 | IDA:GOC | P | protein phosphorylation |
| GO:0042304 | TAS:Reactome | P | regulation of fatty acid biosynthetic process |
| GO:0007165 | TAS:ProtInc | P | signal transduction |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Protein Entry
AAKB2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O43741-1; Sequence=Displayed; Name=2; IsoId=O43741-2; Sequence=VSP_055820, VSP_055821; Note=No experimental confirmation available.; |
| Function | Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3). |
| Interaction | Self; NbExp=2; IntAct=EBI-1053424, EBI-1053424; Q13131:PRKAA1; NbExp=6; IntAct=EBI-1053424, EBI-1181405; P54619:PRKAG1; NbExp=3; IntAct=EBI-1053424, EBI-1181439; |
| Ptm | Phosphorylated when associated with the catalytic subunit (PRKAA1 or PRKAA2). Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK. {ECO |
| Similarity | Belongs to the 5'-AMP-activated protein kinase beta subunit family. |
| Subunit | AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3). |
Identical and Related Proteins
Unique RefSeq proteins for LMP002208 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4885561 | RefSeq | NP_005390 | 272 | 5'-AMP-activated protein kinase subunit beta-2 |
Identical Sequences to LMP002208 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4885561 | GenBank | ACM81691.1 | 272 | Sequence 7189 from patent US 6812339 |
| GI:4885561 | GenBank | ADR82700.1 | 272 | protein kinase, AMP-activated, beta 2 non-catalytic subunit, partial [synthetic construct] |
| GI:4885561 | GenBank | AHD72271.1 | 272 | Sequence 7769 from patent US 8586006 |
| GI:4885561 | GenBank | AIC49470.1 | 272 | PRKAB2, partial [synthetic construct] |
| GI:4885561 | GenBank | AIC62568.1 | 272 | PRKAB2, partial [synthetic construct] |
| GI:4885561 | RefSeq | XP_004026557.1 | 272 | PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 [Gorilla gorilla gorilla] |
Related Sequences to LMP002208 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4885561 | GenBank | AAV38234.1 | 273 | protein kinase, AMP-activated, beta 2 non-catalytic subunit, partial [synthetic construct] |
| GI:4885561 | GenBank | AAV38235.1 | 273 | protein kinase, AMP-activated, beta 2 non-catalytic subunit, partial [synthetic construct] |
| GI:4885561 | GenBank | AAX42791.1 | 273 | protein kinase AMP-activated beta 2 non-catalytic subunit, partial [synthetic construct] |
| GI:4885561 | GenBank | AAX42792.1 | 273 | protein kinase AMP-activated beta 2 non-catalytic subunit, partial [synthetic construct] |
| GI:4885561 | RefSeq | XP_003273262.1 | 272 | PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 [Nomascus leucogenys] |
| GI:4885561 | RefSeq | XP_003809245.1 | 272 | PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 [Pan paniscus] |