Gene/Proteome Database (LMPD)

LMPD ID
LMP002208
Gene ID
5565
Species
Homo sapiens (Human)
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Gene Symbol
PRKAB2
Synonyms
-
Alternate Names
5'-AMP-activated protein kinase subunit beta-2;,AMPK beta 2; AMPK beta-2 chain; AMPK subunit beta-2', "5'-AMP-activated protein kinase, beta-2 subunit;,AMP-activated protein kinase beta 2 non-catalytic subunit
Chromosome
1
Map Location
1q21.1
Summary
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2013]
Orthologs
View orthologs and multiple alignments for PRKAB2

Proteins

5'-AMP-activated protein kinase subunit beta-2
Refseq ID NP_005390
Protein GI 4885561
UniProt ID O43741
mRNA ID NM_005399
Length 272
RefSeq Status REVIEWED
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI

Gene Information

Entrez Gene ID
5565
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Gene Symbol
PRKAB2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031588 IDA:UniProtKB C AMP-activated protein kinase complex
GO:0005829 TAS:Reactome C cytosol
GO:0005654 TAS:Reactome C nucleoplasm
GO:0042802 IPI:IntAct F identical protein binding
GO:0006853 TAS:Reactome P carnitine shuttle
GO:0007050 TAS:Reactome P cell cycle arrest
GO:0044255 TAS:Reactome P cellular lipid metabolic process
GO:0006112 TAS:Reactome P energy reserve metabolic process
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process
GO:0008286 TAS:Reactome P insulin receptor signaling pathway
GO:0061024 TAS:Reactome P membrane organization
GO:0006468 IDA:GOC P protein phosphorylation
GO:0042304 TAS:Reactome P regulation of fatty acid biosynthetic process
GO:0007165 TAS:ProtInc P signal transduction
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04152 AMPK signaling pathway
hsa04068 FoxO signaling pathway
hsa04932 Non-alcoholic fatty liver disease (NAFLD)
hsa04921 Oxytocin signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR006828 Association with the SNF1 complex (ASC) domain
IPR014756 Immunoglobulin E-set

UniProt Annotations

Entry Information

Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Protein Entry
AAKB2_HUMAN
UniProt ID
O43741
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O43741-1; Sequence=Displayed; Name=2; IsoId=O43741-2; Sequence=VSP_055820, VSP_055821; Note=No experimental confirmation available.;
Function Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).
Interaction Self; NbExp=2; IntAct=EBI-1053424, EBI-1053424; Q13131:PRKAA1; NbExp=6; IntAct=EBI-1053424, EBI-1181405; P54619:PRKAG1; NbExp=3; IntAct=EBI-1053424, EBI-1181439;
Ptm Phosphorylated when associated with the catalytic subunit (PRKAA1 or PRKAA2). Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK. {ECO
Similarity Belongs to the 5'-AMP-activated protein kinase beta subunit family.
Subunit AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3).

Identical and Related Proteins

Unique RefSeq proteins for LMP002208 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4885561 RefSeq NP_005390 272 5'-AMP-activated protein kinase subunit beta-2

Identical Sequences to LMP002208 proteins

Reference Database Accession Length Protein Name
GI:4885561 GenBank ACM81691.1 272 Sequence 7189 from patent US 6812339
GI:4885561 GenBank ADR82700.1 272 protein kinase, AMP-activated, beta 2 non-catalytic subunit, partial [synthetic construct]
GI:4885561 GenBank AHD72271.1 272 Sequence 7769 from patent US 8586006
GI:4885561 GenBank AIC49470.1 272 PRKAB2, partial [synthetic construct]
GI:4885561 GenBank AIC62568.1 272 PRKAB2, partial [synthetic construct]
GI:4885561 RefSeq XP_004026557.1 272 PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 [Gorilla gorilla gorilla]

Related Sequences to LMP002208 proteins

Reference Database Accession Length Protein Name
GI:4885561 GenBank AAV38234.1 273 protein kinase, AMP-activated, beta 2 non-catalytic subunit, partial [synthetic construct]
GI:4885561 GenBank AAV38235.1 273 protein kinase, AMP-activated, beta 2 non-catalytic subunit, partial [synthetic construct]
GI:4885561 GenBank AAX42791.1 273 protein kinase AMP-activated beta 2 non-catalytic subunit, partial [synthetic construct]
GI:4885561 GenBank AAX42792.1 273 protein kinase AMP-activated beta 2 non-catalytic subunit, partial [synthetic construct]
GI:4885561 RefSeq XP_003273262.1 272 PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 [Nomascus leucogenys]
GI:4885561 RefSeq XP_003809245.1 272 PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 [Pan paniscus]