Gene/Proteome Database (LMPD)
LMPD ID
LMP002228
Gene ID
Species
Mus musculus (Mouse)
Gene Name
abhydrolase domain containing 5
Gene Symbol
Synonyms
1300003D03Rik; 2010002J10Rik; CDS; CGI-58; IECN5; NCIE2
Alternate Names
1-acylglycerol-3-phosphate O-acyltransferase ABHD5; lipid droplet-binding protein CGI-58; abhydrolase domain-containing protein 5
Chromosome
9
Map Location
9 F4|9
EC Number
2.3.1.51
Proteins
| 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 | |
|---|---|
| Refseq ID | NP_080455 |
| Protein GI | 13385690 |
| UniProt ID | Q9DBL9 |
| mRNA ID | NM_026179 |
| Length | 351 |
| RefSeq Status | VALIDATED |
| MKAMAAEEEVDSADAGGGSGWLTGWLPTWCPTSTSHLKEAEEKMLKCVPCTYKKEPVRISNGNRIWTLMFSHNISSKTPLVLLHGFGGGLGLWALNFEDLSTDRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPDLADQERPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARSCIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTVD | |
Gene Information
Entrez Gene ID
Gene Name
abhydrolase domain containing 5
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IDA:UniProtKB | C | cytosol |
| GO:0005811 | IDA:UniProtKB | C | lipid particle |
| GO:0005634 | IEA:Ensembl | C | nucleus |
| GO:0003841 | IEA:UniProtKB-EC | F | 1-acylglycerol-3-phosphate O-acyltransferase activity |
| GO:0030154 | IEA:UniProtKB-KW | P | cell differentiation |
| GO:0006631 | IEA:UniProtKB-KW | P | fatty acid metabolic process |
| GO:0006629 | ISA:MGI | P | lipid metabolic process |
| GO:0010891 | IDA:UniProtKB | P | negative regulation of sequestering of triglyceride |
| GO:0006654 | ISS:UniProtKB | P | phosphatidic acid biosynthetic process |
| GO:0051006 | IDA:MGI | P | positive regulation of lipoprotein lipase activity |
| GO:0010898 | IDA:UniProtKB | P | positive regulation of triglyceride catabolic process |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9DBL9-1; Sequence=Displayed; Name=2; IsoId=Q9DBL9-2; Sequence=VSP_015345; Note=No experimental confirmation available.; |
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate. |
| Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}. |
| Function | Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis. May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2. Involved in keratinocyte differentiation. {ECO:0000269|PubMed:16679289}. |
| Similarity | Belongs to the peptidase S33 family. ABHD4/ABHD5 subfamily. {ECO:0000305}. |
| Subcellular Location | Cytoplasm. Lipid droplet. Note=Colocalized with PLIN and ADRP on the surface of lipid droplets. The localization is dependent upon the metabolic status of the adipocytes and the activity of PKA. |
| Subunit | Interacts with ADRP (By similarity). Interacts with PLIN. Interacts with and PNPLA2. Interacts with PLIN5; promotes interaction with PNPLA2. {ECO:0000250, ECO:0000269|PubMed:15292255, ECO:0000269|PubMed:16679289, ECO:0000269|PubMed:19064991, ECO:0000269|PubMed:21148142}. |
| Tissue Specificity | Highly expressed in the adipose tissue and testes. Weakly expressed in the liver, muscle, kidney, and heart. Expressed by upper epidermal layers and dermal fibroblasts in skin, hepatocytes and hypothalamus in brain (at protein level). {ECO:0000269|PubMed:15292255, ECO:0000269|PubMed:16679289, ECO:0000269|PubMed:18832586}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002228 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 13385690 | RefSeq | NP_080455 | 351 | 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 |
Identical Sequences to LMP002228 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13385690 | DBBJ | BAB23632.1 | 351 | unnamed protein product [Mus musculus] |
| GI:13385690 | DBBJ | BAC34220.1 | 351 | unnamed protein product [Mus musculus] |
| GI:13385690 | GenBank | AAH37063.1 | 351 | Abhydrolase domain containing 5 [Mus musculus] |
| GI:13385690 | GenBank | EDL09112.1 | 351 | abhydrolase domain containing 5, isoform CRA_d [Mus musculus] |
| GI:13385690 | GenBank | AGU38076.1 | 351 | Sequence 12 from patent US 8507754 |
| GI:13385690 | SwissProt | Q9DBL9.1 | 351 | RecName: Full=1-acylglycerol-3-phosphate O-acyltransferase ABHD5; AltName: Full=Abhydrolase domain-containing protein 5; AltName: Full=Lipid droplet-binding protein CGI-58; Short=Protein CGI-58 [Mus musculus] |
Related Sequences to LMP002228 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13385690 | GenBank | AAS57860.1 | 351 | CGI-58-like protein [Rattus norvegicus] |
| GI:13385690 | GenBank | AAI27471.1 | 375 | Abhd5 protein, partial [Rattus norvegicus] |
| GI:13385690 | GenBank | EDL76799.1 | 351 | CGI-58-like protein, isoform CRA_a [Rattus norvegicus] |
| GI:13385690 | RefSeq | NP_997689.1 | 351 | 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 [Rattus norvegicus] |
| GI:13385690 | RefSeq | XP_006982945.1 | 348 | PREDICTED: 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 isoform X1 [Peromyscus maniculatus bairdii] |
| GI:13385690 | SwissProt | Q6QA69.1 | 351 | RecName: Full=1-acylglycerol-3-phosphate O-acyltransferase ABHD5; AltName: Full=Abhydrolase domain-containing protein 5; AltName: Full=Lipid droplet-binding protein CGI-58; Short=Protein CGI-58 [Rattus norvegicus] |