Gene/Proteome Database (LMPD)

LMPD ID
LMP002228
Gene ID
67469
Species
Mus musculus (Mouse)
Gene Name
abhydrolase domain containing 5
Gene Symbol
Abhd5
Synonyms
1300003D03Rik; 2010002J10Rik; CDS; CGI-58; IECN5; NCIE2
Alternate Names
1-acylglycerol-3-phosphate O-acyltransferase ABHD5; lipid droplet-binding protein CGI-58; abhydrolase domain-containing protein 5
Chromosome
9
Map Location
9 F4|9
EC Number
2.3.1.51

Proteins

1-acylglycerol-3-phosphate O-acyltransferase ABHD5
Refseq ID NP_080455
Protein GI 13385690
UniProt ID Q9DBL9
mRNA ID NM_026179
Length 351
RefSeq Status VALIDATED
MKAMAAEEEVDSADAGGGSGWLTGWLPTWCPTSTSHLKEAEEKMLKCVPCTYKKEPVRISNGNRIWTLMFSHNISSKTPLVLLHGFGGGLGLWALNFEDLSTDRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPDLADQERPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARSCIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTVD

Gene Information

Entrez Gene ID
67469
Gene Name
abhydrolase domain containing 5
Gene Symbol
Abhd5
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:UniProtKB C cytosol
GO:0005811 IDA:UniProtKB C lipid particle
GO:0005634 IEA:Ensembl C nucleus
GO:0003841 IEA:UniProtKB-EC F 1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0030154 IEA:UniProtKB-KW P cell differentiation
GO:0006631 IEA:UniProtKB-KW P fatty acid metabolic process
GO:0006629 ISA:MGI P lipid metabolic process
GO:0010891 IDA:UniProtKB P negative regulation of sequestering of triglyceride
GO:0006654 ISS:UniProtKB P phosphatidic acid biosynthetic process
GO:0051006 IDA:MGI P positive regulation of lipoprotein lipase activity
GO:0010898 IDA:UniProtKB P positive regulation of triglyceride catabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
5893263 Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis
5893264 Lipid digestion, mobilization, and transport
5892760 Metabolism
5892799 Metabolism of lipids and lipoproteins

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR000073 Alpha/beta hydrolase fold-1

UniProt Annotations

Entry Information

Gene Name
abhydrolase domain containing 5
Protein Entry
ABHD5_MOUSE
UniProt ID
Q9DBL9
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9DBL9-1; Sequence=Displayed; Name=2; IsoId=Q9DBL9-2; Sequence=VSP_015345; Note=No experimental confirmation available.;
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}.
Function Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis. May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2. Involved in keratinocyte differentiation. {ECO:0000269|PubMed:16679289}.
Similarity Belongs to the peptidase S33 family. ABHD4/ABHD5 subfamily. {ECO:0000305}.
Subcellular Location Cytoplasm. Lipid droplet. Note=Colocalized with PLIN and ADRP on the surface of lipid droplets. The localization is dependent upon the metabolic status of the adipocytes and the activity of PKA.
Subunit Interacts with ADRP (By similarity). Interacts with PLIN. Interacts with and PNPLA2. Interacts with PLIN5; promotes interaction with PNPLA2. {ECO:0000250, ECO:0000269|PubMed:15292255, ECO:0000269|PubMed:16679289, ECO:0000269|PubMed:19064991, ECO:0000269|PubMed:21148142}.
Tissue Specificity Highly expressed in the adipose tissue and testes. Weakly expressed in the liver, muscle, kidney, and heart. Expressed by upper epidermal layers and dermal fibroblasts in skin, hepatocytes and hypothalamus in brain (at protein level). {ECO:0000269|PubMed:15292255, ECO:0000269|PubMed:16679289, ECO:0000269|PubMed:18832586}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002228 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13385690 RefSeq NP_080455 351 1-acylglycerol-3-phosphate O-acyltransferase ABHD5

Identical Sequences to LMP002228 proteins

Reference Database Accession Length Protein Name
GI:13385690 DBBJ BAB23632.1 351 unnamed protein product [Mus musculus]
GI:13385690 DBBJ BAC34220.1 351 unnamed protein product [Mus musculus]
GI:13385690 GenBank AAH37063.1 351 Abhydrolase domain containing 5 [Mus musculus]
GI:13385690 GenBank EDL09112.1 351 abhydrolase domain containing 5, isoform CRA_d [Mus musculus]
GI:13385690 GenBank AGU38076.1 351 Sequence 12 from patent US 8507754
GI:13385690 SwissProt Q9DBL9.1 351 RecName: Full=1-acylglycerol-3-phosphate O-acyltransferase ABHD5; AltName: Full=Abhydrolase domain-containing protein 5; AltName: Full=Lipid droplet-binding protein CGI-58; Short=Protein CGI-58 [Mus musculus]

Related Sequences to LMP002228 proteins

Reference Database Accession Length Protein Name
GI:13385690 GenBank AAS57860.1 351 CGI-58-like protein [Rattus norvegicus]
GI:13385690 GenBank AAI27471.1 375 Abhd5 protein, partial [Rattus norvegicus]
GI:13385690 GenBank EDL76799.1 351 CGI-58-like protein, isoform CRA_a [Rattus norvegicus]
GI:13385690 RefSeq NP_997689.1 351 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 [Rattus norvegicus]
GI:13385690 RefSeq XP_006982945.1 348 PREDICTED: 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 isoform X1 [Peromyscus maniculatus bairdii]
GI:13385690 SwissProt Q6QA69.1 351 RecName: Full=1-acylglycerol-3-phosphate O-acyltransferase ABHD5; AltName: Full=Abhydrolase domain-containing protein 5; AltName: Full=Lipid droplet-binding protein CGI-58; Short=Protein CGI-58 [Rattus norvegicus]