Gene/Proteome Database (LMPD)

LMPD ID
LMP002339
Gene ID
2523
Species
Homo sapiens (Human)
Gene Name
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Gene Symbol
FUT1
Synonyms
H; HH; HSC
Alternate Names
galactoside 2-alpha-L-fucosyltransferase 1; alpha(1,2)FT 1; 2-alpha-L-fucosyltransferase; alpha (1,2) fucosyltransferase; alpha(1,2) fucosyltransferase 1; blood group H alpha 2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase)
Chromosome
19
Map Location
19q13.3
EC Number
2.4.1.69
Summary
The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for FUT1

Proteins

galactoside 2-alpha-L-fucosyltransferase 1
Refseq ID NP_000139
Protein GI 4503805
UniProt ID P19526
mRNA ID NM_000148
Length 365
RefSeq Status REVIEWED
MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP

Gene Information

Entrez Gene ID
2523
Gene Name
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Gene Symbol
FUT1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 TAS:UniProtKB C Golgi apparatus
GO:0005887 TAS:ProtInc C integral component of plasma membrane
GO:0016020 TAS:ProtInc C membrane
GO:0008417 TAS:ProtInc F fucosyltransferase activity
GO:0008107 TAS:UniProtKB F galactoside 2-alpha-L-fucosyltransferase activity
GO:0042355 NAS:UniProtKB P L-fucose catabolic process
GO:0005975 TAS:ProtInc P carbohydrate metabolic process
GO:0006486 TAS:UniProtKB P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
hsa00603 Glycosphingolipid biosynthesis - globo series
hsa00601 Glycosphingolipid biosynthesis - lacto and neolacto series
hsa01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR002516 Glycosyl transferase, family 11

UniProt Annotations

Entry Information

Gene Name
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Protein Entry
FUT1_HUMAN
UniProt ID
P19526
Species
Human

Comments

Comment Type Description
Catalytic Activity GDP-beta-L-fucose + beta-D-galactosyl-(1->3)- N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta- D-glucosyl-(1<->1)-ceramide = GDP + alpha-L-fucosyl-(1->2)-beta-D- galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D- galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide.
Function Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values.
Miscellaneous There are two genes (FUT1 and FUT2) which encode galactoside 2-L-fucosyltransferase. They are expressed in a tissue-specific manner with expression restricted to cells of mesodermal or endodermal origin respectively.
Pathway Protein modification; protein glycosylation.
Polymorphism Nonfunctional mutant of FUT1 are the cause of the H- Bombay blood group.
Similarity Belongs to the glycosyltransferase 11 family.
Subcellular Location Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Membrane-bound form in trans cisternae of Golgi.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=Fucosyltransferase 1; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_598";
Web Resource Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=FUT1";
Web Resource Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/fut1/";
Web Resource Name=dbRBC/BGMUT; Note=Blood group antigen gene mutation database; URL="http://www.ncbi.nlm.nih.gov/gv/mhc/xslcgi.cgi?cmd=bgmut/systems_info&system=hh";

Identical and Related Proteins

Unique RefSeq proteins for LMP002339 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4503805 RefSeq NP_000139 365 galactoside 2-alpha-L-fucosyltransferase 1

Identical Sequences to LMP002339 proteins

Reference Database Accession Length Protein Name
GI:4503805 EMBL CAQ81977.1 365 fucosyltransferase [Homo sapiens]
GI:4503805 GenBank ABL22092.1 365 Sequence 10 from patent US 7126039
GI:4503805 GenBank EAW52399.1 365 hCG16221 [Homo sapiens]
GI:4503805 GenBank AFG79839.1 365 Sequence 98 from patent US 8137928
GI:4503805 GenBank AHJ09661.1 365 alpha(1,2) fucosyltransferase 1 [Homo sapiens]
GI:4503805 GenBank AIC48793.1 365 FUT1, partial [synthetic construct]

Related Sequences to LMP002339 proteins

Reference Database Accession Length Protein Name
GI:4503805 EMBL CAC81751.1 365 fucosyltransferase 1 [Homo sapiens]
GI:4503805 GenBank AAY96648.1 365 2-alpha-L-fucosyltransferase [Homo sapiens]
GI:4503805 GenBank ABC59307.1 365 alpha (1,2) fucosyltransferase [Homo sapiens]
GI:4503805 GenBank ACM85855.1 399 Sequence 11353 from patent US 6812339
GI:4503805 GenBank AFO67890.1 365 fucosyltransferase 1 [Homo sapiens]
GI:4503805 RefSeq XP_006723190.1 488 PREDICTED: galactoside 2-alpha-L-fucosyltransferase 1 isoform X1 [Homo sapiens]