Gene/Proteome Database (LMPD)
LMPD ID
LMP002339
Gene ID
Species
Homo sapiens (Human)
Gene Name
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Gene Symbol
Synonyms
H; HH; HSC
Alternate Names
galactoside 2-alpha-L-fucosyltransferase 1; alpha(1,2)FT 1; 2-alpha-L-fucosyltransferase; alpha (1,2) fucosyltransferase; alpha(1,2) fucosyltransferase 1; blood group H alpha 2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase)
Chromosome
19
Map Location
19q13.3
EC Number
2.4.1.69
Summary
The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| galactoside 2-alpha-L-fucosyltransferase 1 | |
|---|---|
| Refseq ID | NP_000139 |
| Protein GI | 4503805 |
| UniProt ID | P19526 |
| mRNA ID | NM_000148 |
| Length | 365 |
| RefSeq Status | REVIEWED |
| MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP | |
Gene Information
Entrez Gene ID
Gene Name
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | TAS:UniProtKB | C | Golgi apparatus |
| GO:0005887 | TAS:ProtInc | C | integral component of plasma membrane |
| GO:0016020 | TAS:ProtInc | C | membrane |
| GO:0008417 | TAS:ProtInc | F | fucosyltransferase activity |
| GO:0008107 | TAS:UniProtKB | F | galactoside 2-alpha-L-fucosyltransferase activity |
| GO:0042355 | NAS:UniProtKB | P | L-fucose catabolic process |
| GO:0005975 | TAS:ProtInc | P | carbohydrate metabolic process |
| GO:0006486 | TAS:UniProtKB | P | protein glycosylation |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002516 | Glycosyl transferase, family 11 |
UniProt Annotations
Entry Information
Gene Name
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Protein Entry
FUT1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | GDP-beta-L-fucose + beta-D-galactosyl-(1->3)- N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta- D-glucosyl-(1<->1)-ceramide = GDP + alpha-L-fucosyl-(1->2)-beta-D- galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D- galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide. |
| Function | Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values. |
| Miscellaneous | There are two genes (FUT1 and FUT2) which encode galactoside 2-L-fucosyltransferase. They are expressed in a tissue-specific manner with expression restricted to cells of mesodermal or endodermal origin respectively. |
| Pathway | Protein modification; protein glycosylation. |
| Polymorphism | Nonfunctional mutant of FUT1 are the cause of the H- Bombay blood group. |
| Similarity | Belongs to the glycosyltransferase 11 family. |
| Subcellular Location | Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Membrane-bound form in trans cisternae of Golgi. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Fucosyltransferase 1; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_598"; |
| Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=FUT1"; |
| Web Resource | Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/fut1/"; |
| Web Resource | Name=dbRBC/BGMUT; Note=Blood group antigen gene mutation database; URL="http://www.ncbi.nlm.nih.gov/gv/mhc/xslcgi.cgi?cmd=bgmut/systems_info&system=hh"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP002339 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4503805 | RefSeq | NP_000139 | 365 | galactoside 2-alpha-L-fucosyltransferase 1 |
Identical Sequences to LMP002339 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4503805 | EMBL | CAQ81977.1 | 365 | fucosyltransferase [Homo sapiens] |
| GI:4503805 | GenBank | ABL22092.1 | 365 | Sequence 10 from patent US 7126039 |
| GI:4503805 | GenBank | EAW52399.1 | 365 | hCG16221 [Homo sapiens] |
| GI:4503805 | GenBank | AFG79839.1 | 365 | Sequence 98 from patent US 8137928 |
| GI:4503805 | GenBank | AHJ09661.1 | 365 | alpha(1,2) fucosyltransferase 1 [Homo sapiens] |
| GI:4503805 | GenBank | AIC48793.1 | 365 | FUT1, partial [synthetic construct] |
Related Sequences to LMP002339 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4503805 | EMBL | CAC81751.1 | 365 | fucosyltransferase 1 [Homo sapiens] |
| GI:4503805 | GenBank | AAY96648.1 | 365 | 2-alpha-L-fucosyltransferase [Homo sapiens] |
| GI:4503805 | GenBank | ABC59307.1 | 365 | alpha (1,2) fucosyltransferase [Homo sapiens] |
| GI:4503805 | GenBank | ACM85855.1 | 399 | Sequence 11353 from patent US 6812339 |
| GI:4503805 | GenBank | AFO67890.1 | 365 | fucosyltransferase 1 [Homo sapiens] |
| GI:4503805 | RefSeq | XP_006723190.1 | 488 | PREDICTED: galactoside 2-alpha-L-fucosyltransferase 1 isoform X1 [Homo sapiens] |