Gene/Proteome Database (LMPD)
LMPD ID
LMP002352
Gene ID
Species
Mus musculus (Mouse)
Gene Name
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9)
Gene Symbol
Synonyms
-
Alternate Names
ATP synthase F(0) complex subunit C1, mitochondrial; ATPase protein 9; ATPase subunit c; ATP synthase proteolipid P1; ATP synthase lipid-binding protein, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1
Chromosome
11
Map Location
11 D|11
Proteins
| ATP synthase F(0) complex subunit C1, mitochondrial | |
|---|---|
| Refseq ID | NP_001154891 |
| Protein GI | 238637299 |
| UniProt ID | Q9CR84 |
| mRNA ID | NM_001161419 |
| Length | 136 |
| RefSeq Status | VALIDATED |
| MQTTKALLISPALIRSCTRGLIRPVSASLLSRPEAPSKQPSCSSSPLQVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
| ATP synthase F(0) complex subunit C1, mitochondrial | |
|---|---|
| Refseq ID | NP_031532 |
| Protein GI | 31982497 |
| UniProt ID | Q9CR84 |
| mRNA ID | NM_007506 |
| Length | 136 |
| RefSeq Status | VALIDATED |
| Protein sequence is identical to GI:238637299 (mRNA isoform) | |
| transit_peptide: 1..61 experiment: experimental evidence, no additional details recorded note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (Q9CR84.1) calculated_mol_wt: 6610 peptide sequence: MQTTKALLISPALIRSCTRGLIRPVSASLLSRPEAPSKQPSCSSSPLQVARREFQTSVISR mat_peptide: 62..136 product: ATP synthase F(0) complex subunit C1, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9CR84.1) calculated_mol_wt: 7608 peptide sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM transit_peptide: 1..61 experiment: experimental evidence, no additional details recorded note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (Q9CR84.1) calculated_mol_wt: 6610 peptide sequence: MQTTKALLISPALIRSCTRGLIRPVSASLLSRPEAPSKQPSCSSSPLQVARREFQTSVISR mat_peptide: 62..136 product: ATP synthase F(0) complex subunit C1, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9CR84.1) calculated_mol_wt: 7608 peptide sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
Gene Information
Entrez Gene ID
Gene Name
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005743 | IDA:MGI | C | mitochondrial inner membrane |
| GO:0005753 | ISS:UniProtKB | C | mitochondrial proton-transporting ATP synthase complex |
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0045263 | IEA:UniProtKB-KW | C | proton-transporting ATP synthase complex, coupling factor F(o) |
| GO:0015078 | IEA:InterPro | F | hydrogen ion transmembrane transporter activity |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0015991 | IEA:InterPro | P | ATP hydrolysis coupled proton transport |
| GO:0015986 | IEA:InterPro | P | ATP synthesis coupled proton transport |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9)
Protein Entry
AT5G1_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Disease | Note=This protein is the major protein stored in the storage bodies of animals or humans affected with ceroid lipofuscinosis (Batten disease). |
| Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element (By similarity). {ECO:0000250}. |
| Miscellaneous | There are three genes which encode the mitochondrial ATP synthase proteolipid and they specify precursors with different import sequences but identical mature proteins. {ECO:0000305}. |
| Similarity | Belongs to the ATPase C chain family. {ECO:0000305}. |
| Subcellular Location | Mitochondrion membrane {ECO:0000250}; Multi- pass membrane protein {ECO:0000250}. |
| Subunit | F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Component of an ATP synthase complex composed of ATP5F1, ATP5G1, ATP5E, ATP5H, ATP5I, ATP5J, ATP5J2, MT-ATP6, MT-ATP8, ATP5A1, ATP5B, ATP5D, ATP5C1, ATP5O, ATP5L, USMG5 and MP68 (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002352 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 238637299 | RefSeq | NP_001154891 | 136 | ATP synthase F(0) complex subunit C1, mitochondrial |
Identical Sequences to LMP002352 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:238637299 | GenBank | AAH94664.1 | 136 | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Mus musculus] |
| GI:238637299 | GenBank | EDL16011.1 | 136 | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] |
| GI:238637299 | GenBank | EDL16012.1 | 136 | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] |
| GI:238637299 | GenBank | EDL16013.1 | 136 | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] |
| GI:238637299 | RefSeq | NP_031532.2 | 136 | ATP synthase F(0) complex subunit C1, mitochondrial [Mus musculus] |
| GI:238637299 | SwissProt | Q9CR84.1 | 136 | RecName: Full=ATP synthase F(0) complex subunit C1, mitochondrial; AltName: Full=ATP synthase lipid-binding protein; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor [Mus musculus] |
Related Sequences to LMP002352 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:238637299 | DBBJ | BAE39897.1 | 136 | unnamed protein product [Mus musculus] |
| GI:238637299 | GenBank | AAA16434.1 | 136 | H+ ATP synthase [Mus musculus] |
| GI:238637299 | GenBank | EDL02565.1 | 136 | mCG134178 [Mus musculus] |
| GI:238637299 | RefSeq | XP_005368423.1 | 136 | PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform X4 [Microtus ochrogaster] |
| GI:238637299 | RefSeq | XP_005368424.1 | 136 | PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform X5 [Microtus ochrogaster] |
| GI:238637299 | RefSeq | XP_007631094.1 | 136 | PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial [Cricetulus griseus] |