Gene/Proteome Database (LMPD)
LMPD ID
LMP002378
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidylinositol transfer protein, alpha
Gene Symbol
Synonyms
HEL-S-36; PI-TPalpha; PITPN; VIB1A
Alternate Names
phosphatidylinositol transfer protein alpha isoform; PI-TP-alpha; ptdInsTP alpha; ptdIns transfer protein alpha; epididymis secretory protein Li 36
Chromosome
17
Map Location
17p13.3
Summary
This gene encodes a member of a family of lipid-binding proteins that transfer molecules of phosphatidylinositol or phosphatidylcholine between membrane surfaces. The protein is implicated in phospholipase C signaling and in the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3) by phosphoinositide-3-kinase.[provided by RefSeq, Sep 2009]
Orthologs
Proteins
| phosphatidylinositol transfer protein alpha isoform | |
|---|---|
| Refseq ID | NP_006215 |
| Protein GI | 5453908 |
| UniProt ID | Q00169 |
| mRNA ID | NM_006224 |
| Length | 270 |
| RefSeq Status | REVIEWED |
| MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol transfer protein, alpha
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0008525 | TAS:ProtInc | F | phosphatidylcholine transporter activity |
| GO:0008526 | TAS:ProtInc | F | phosphatidylinositol transporter activity |
| GO:0007411 | TAS:Reactome | P | axon guidance |
| GO:0006629 | NAS:ProtInc | P | lipid metabolic process |
| GO:0015914 | TAS:GOC | P | phospholipid transport |
| GO:0007601 | TAS:ProtInc | P | visual perception |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_111045 | Developmental Biology |
| REACT_22237 | Netrin-1 signaling |
| REACT_22228 | Role of second messengers in netrin-1 signaling |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol transfer protein, alpha
Protein Entry
PIPNA_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes. |
| Similarity | Belongs to the PtdIns transfer protein family. PI transfer class I subfamily. |
| Subcellular Location | Cytoplasm. |
| Tissue Specificity | Expressed in a wide range of tissues. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002378 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 5453908 | RefSeq | NP_006215 | 270 | phosphatidylinositol transfer protein alpha isoform |
Identical Sequences to LMP002378 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5453908 | GenBank | JAA13547.1 | 270 | phosphatidylinositol transfer protein, alpha [Pan troglodytes] |
| GI:5453908 | GenBank | JAA28275.1 | 270 | phosphatidylinositol transfer protein, alpha [Pan troglodytes] |
| GI:5453908 | GenBank | AHD76812.1 | 270 | Sequence 21032 from patent US 8586006 |
| GI:5453908 | GenBank | AIC49401.1 | 270 | PITPNA, partial [synthetic construct] |
| GI:5453908 | GenBank | AIC63111.1 | 270 | PITPNA, partial [synthetic construct] |
| GI:5453908 | RefSeq | XP_009429805.1 | 270 | PREDICTED: phosphatidylinositol transfer protein alpha isoform isoform X1 [Pan troglodytes] |
Related Sequences to LMP002378 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5453908 | RefSeq | XP_002918086.1 | 270 | PREDICTED: phosphatidylinositol transfer protein alpha isoform-like [Ailuropoda melanoleuca] |
| GI:5453908 | RefSeq | XP_537767.3 | 270 | PREDICTED: phosphatidylinositol transfer protein alpha isoform [Canis lupus familiaris] |
| GI:5453908 | RefSeq | XP_004404163.1 | 270 | PREDICTED: phosphatidylinositol transfer protein alpha isoform [Odobenus rosmarus divergens] |
| GI:5453908 | RefSeq | XP_004433373.1 | 270 | PREDICTED: phosphatidylinositol transfer protein alpha isoform [Ceratotherium simum simum] |
| GI:5453908 | RefSeq | XP_006741452.1 | 270 | PREDICTED: phosphatidylinositol transfer protein alpha isoform [Leptonychotes weddellii] |
| GI:5453908 | RefSeq | XP_008693510.1 | 270 | PREDICTED: phosphatidylinositol transfer protein alpha isoform [Ursus maritimus] |