Gene/Proteome Database (LMPD)
Proteins
| isopentenyl-diphosphate Delta-isomerase 1 | |
|---|---|
| Refseq ID | NP_663335 |
| Protein GI | 281604088 |
| UniProt ID | P58044 |
| mRNA ID | NM_145360 |
| Length | 283 |
| RefSeq Status | VALIDATED |
| MWRGRTLARAIGYAVRGRGLEAEHAAERIEVQLSAQLLSTCSRNLCVLGQIRHSVTMPEINTSHLDEKQVQLLAEMCILIDENDNKIGADTKKNCHLNENIDKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNSCCSHPLSNPGELEENNAIGVKRAAKRRLKAELGIPLEEVDLNEMDYLTRIYYKAQSDGIWGEHEVDYILFLRKNVTLNPDPNEIKSYCYVSKEEVREILKKAASGEIKLTPWFKIIADTFLFKWWDNLNHLSPFVDHEKIHRL | |
Gene Information
Entrez Gene ID
Gene Name
isopentenyl-diphosphate delta isomerase
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0005777 | IEA:Ensembl | C | peroxisome |
| GO:0016787 | IEA:InterPro | F | hydrolase activity |
| GO:0004452 | IEA:InterPro | F | isopentenyl-diphosphate delta-isomerase activity |
| GO:0000287 | IEA:Ensembl | F | magnesium ion binding |
| GO:0030145 | IEA:Ensembl | F | manganese ion binding |
| GO:0008299 | IEA:InterPro | P | isoprenoid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
isopentenyl-diphosphate delta isomerase
Protein Entry
IDI1_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP002434 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 281604088 | RefSeq | NP_663335 | 283 | isopentenyl-diphosphate Delta-isomerase 1 |
Identical Sequences to LMP002434 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:281604088 | GenBank | EDL32280.1 | 283 | isopentenyl-diphosphate delta isomerase [Mus musculus] |
Related Sequences to LMP002434 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:281604088 | GenBank | EDL86437.1 | 283 | isopentenyl-diphosphate delta isomerase [Rattus norvegicus] |
| GI:281604088 | GenBank | EGV95102.1 | 285 | Isopentenyl-diphosphate Delta-isomerase 1 [Cricetulus griseus] |
| GI:281604088 | RefSeq | NP_445991.2 | 283 | isopentenyl-diphosphate Delta-isomerase 1 [Rattus norvegicus] |
| GI:281604088 | RefSeq | XP_005365461.1 | 282 | PREDICTED: isopentenyl-diphosphate Delta-isomerase 1 [Microtus ochrogaster] |
| GI:281604088 | RefSeq | XP_006987910.1 | 283 | PREDICTED: isopentenyl-diphosphate Delta-isomerase 1 [Peromyscus maniculatus bairdii] |
| GI:281604088 | RefSeq | XP_007636240.1 | 285 | PREDICTED: isopentenyl-diphosphate Delta-isomerase 1 isoform X1 [Cricetulus griseus] |