Gene/Proteome Database (LMPD)
LMPD ID
LMP002464
Gene ID
Species
Mus musculus (Mouse)
Gene Name
pleckstrin homology domain-containing, family A (phosphoinositide binding specific) member 3
Gene Symbol
Synonyms
FAPP1
Alternate Names
pleckstrin homology domain-containing family A member 3; FAPP-1; PH domain-containing family A member 3; phosphoinositol 4-phosphate adapter protein 1; phosphatidylinositol-four-phosphate adapter protein 1
Chromosome
2
Map Location
2|2 D
Proteins
| pleckstrin homology domain-containing family A member 3 | |
|---|---|
| Refseq ID | NP_112546 |
| Protein GI | 13752585 |
| UniProt ID | Q9ERS4 |
| mRNA ID | NM_031256 |
| Length | 297 |
| RefSeq Status | VALIDATED |
| MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHPADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTAKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHRDERHPSPSVENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLPHPDPLVSPVSPSPVQMMKRSASHPGSCSSERSSCSIKEPASALHRLPQRRRRTYSDTDSCNDVPPEDPERPLHCSGNTLNGDLASATIPEESRLMAKTQSEEPLLPFS | |
Gene Information
Entrez Gene ID
Gene Name
pleckstrin homology domain-containing, family A (phosphoinositide binding specific) member 3
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016020 | IEA:UniProtKB-KW | C | membrane |
| GO:0005545 | IDA:MGI | F | 1-phosphatidylinositol binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
pleckstrin homology domain-containing, family A (phosphoinositide binding specific) member 3
Protein Entry
PKHA3_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Domain | The PH domain of FAPPS binds the small GTPase ARF1 and phosphatidylinositol-4-phosphate (PtdIns4P) with high selectivity, and is required for recruitment of FAPPs to the trans-Golgi network (TGN). {ECO:0000250}. |
| Function | Involved in Golgi to cell surface membrane traffic. Induces membrane tubulation. Binds preferentially to phosphatidylinositol 4-phosphate (PtdIns4P) (By similarity). {ECO:0000250}. |
| Similarity | Contains 1 PH domain. {ECO:0000255|PROSITE- ProRule:PRU00145}. |
| Subcellular Location | Golgi apparatus, trans-Golgi network membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}. |
| Subunit | Interacts with GTP-bound ARF1. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002464 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 13752585 | RefSeq | NP_112546 | 297 | pleckstrin homology domain-containing family A member 3 |
Identical Sequences to LMP002464 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13752585 | GenBank | AAG15200.1 | 297 | Phosphoinositol 4-phosphate Adaptor Protein-1 [Mus musculus] |
| GI:13752585 | GenBank | AAH31110.1 | 297 | Pleckstrin homology domain-containing, family A (phosphoinositide binding specific) member 3 [Mus musculus] |
| GI:13752585 | GenBank | EDL27216.1 | 297 | pleckstrin homology domain-containing, family A (phosphoinositide binding specific) member 3 [Mus musculus] |
| GI:13752585 | RefSeq | XP_006500508.1 | 297 | PREDICTED: pleckstrin homology domain-containing family A member 3 isoform X1 [Mus musculus] |
| GI:13752585 | RefSeq | XP_006500509.1 | 297 | PREDICTED: pleckstrin homology domain-containing family A member 3 isoform X2 [Mus musculus] |
| GI:13752585 | SwissProt | Q9ERS4.1 | 297 | RecName: Full=Pleckstrin homology domain-containing family A member 3; Short=PH domain-containing family A member 3; AltName: Full=Phosphatidylinositol-four-phosphate adapter protein 1; Short=FAPP-1; Short=Phosphoinositol 4-phosphate adapter protein 1 [Mus musculus] |
Related Sequences to LMP002464 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13752585 | GenBank | AAH83759.1 | 299 | Pleckstrin homology domain-containing, family A (phosphoinositide binding specific) member 3 [Rattus norvegicus] |
| GI:13752585 | RefSeq | NP_001013095.1 | 299 | pleckstrin homology domain-containing family A member 3 [Rattus norvegicus] |
| GI:13752585 | RefSeq | XP_003478565.1 | 300 | PREDICTED: pleckstrin homology domain-containing family A member 3 [Cavia porcellus] |
| GI:13752585 | RefSeq | XP_005065180.1 | 299 | PREDICTED: pleckstrin homology domain-containing family A member 3 [Mesocricetus auratus] |
| GI:13752585 | RefSeq | XP_005346679.1 | 299 | PREDICTED: pleckstrin homology domain-containing family A member 3 [Microtus ochrogaster] |
| GI:13752585 | RefSeq | XP_008853565.1 | 299 | PREDICTED: pleckstrin homology domain-containing family A member 3 [Nannospalax galili] |