Gene/Proteome Database (LMPD)

LMPD ID
LMP002479
Gene ID
Species
Homo sapiens (Human)
Gene Name
leukotriene C4 synthase
Gene Symbol
Synonyms
-
Alternate Names
leukotriene C4 synthase; LTC4 synthase
Chromosome
5
Map Location
5q35
EC Number
4.4.1.20
Summary
The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

leukotriene C4 synthase
Refseq ID NP_665874
Protein GI 22035629
UniProt ID Q16873
mRNA ID NM_145867
Length 150
RefSeq Status REVIEWED
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA

Gene Information

Entrez Gene ID
Gene Name
leukotriene C4 synthase
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:UniProtKB C endoplasmic reticulum
GO:0016021 TAS:ProtInc C integral component of membrane
GO:0043231 TAS:ProtInc C intracellular membrane-bounded organelle
GO:0005635 IDA:UniProtKB C nuclear envelope
GO:0008047 IEA:InterPro F enzyme activator activity
GO:0004602 IBA:RefGenome F glutathione peroxidase activity
GO:0004364 IBA:RefGenome F glutathione transferase activity
GO:0004464 IDA:MGI F leukotriene-C4 synthase activity
GO:0008289 IDA:MGI F lipid binding
GO:0019369 TAS:Reactome P arachidonic acid metabolic process
GO:0019370 IBA:RefGenome P leukotriene biosynthetic process
GO:0006691 IDA:MGI P leukotriene metabolic process
GO:2001300 TAS:Reactome P lipoxin metabolic process
GO:0019372 TAS:Reactome P lipoxygenase pathway
GO:0055114 IBA:GOC P oxidation-reduction process
GO:0044281 TAS:Reactome P small molecule metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_150209 Synthesis of 5-eicosatetraenoic acids
REACT_150420 Synthesis of Leukotrienes (LT) and Eoxins (EX)
REACT_150320 Synthesis of Lipoxins (LX)

Domain Information

InterPro Annotations

Accession Description
IPR001446 5-lipoxygenase-activating protein
IPR018295 FLAP/GST2/LTC4S, conserved site
IPR023352 Membrane associated eicosanoid/glutathione metabolism-like domain
IPR001129 Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein

UniProt Annotations

Entry Information

Gene Name
leukotriene C4 synthase
Protein Entry
LTC4S_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Catalytic Activity Leukotriene C(4) = leukotriene A(4) + glutathione.
Disease Note=LTC4 synthase deficiency is associated with a neurometabolic developmental disorder characterized by muscular hypotonia, psychomotor retardation, failure to thrive, and microcephaly.
Function Catalyzes the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4.
Similarity Belongs to the MAPEG family.
Subcellular Location Nucleus outer membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Subunit Homotrimer. Interacts with ALOX5AP and ALOX5. {ECO
Tissue Specificity Detected in lung, platelets and the myelogenous leukemia cell line KG-1 (at protein level). LTC4S activity is present in eosinophils, basophils, mast cells, certain phagocytic mononuclear cells, endothelial cells, vascular smooth muscle cells and platelets.

Identical and Related Proteins

Unique RefSeq proteins for LMP002479 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22035629 RefSeq NP_665874 150 leukotriene C4 synthase

Identical Sequences to LMP002479 proteins

Reference Database Accession Length Protein Name
GI:22035629 EMBL CAD12184.1 150 unnamed protein product [Homo sapiens]
GI:22035629 GenBank AAB06723.1 150 leukotriene C4 synthase [Homo sapiens]
GI:22035629 GenBank AAE26770.1 150 Sequence 2 from patent US 5952210
GI:22035629 GenBank ABA38401.1 150 Sequence 2 from patent US 6939674
GI:22035629 GenBank EAW53798.1 150 leukotriene C4 synthase, isoform CRA_c [Homo sapiens]
GI:22035629 SwissProt Q16873.1 150 RecName: Full=Leukotriene C4 synthase; Short=LTC4 synthase; AltName: Full=Leukotriene-C(4) synthase [Homo sapiens]

Related Sequences to LMP002479 proteins

Reference Database Accession Length Protein Name
GI:22035629 GenBank ACM85718.1 182 Sequence 11216 from patent US 6812339
GI:22035629 PDB 2PNO 156 Chain B, Crystal Structure Of Human Leukotriene C4 Synthase
GI:22035629 PDB 2PNO 156 Chain C, Crystal Structure Of Human Leukotriene C4 Synthase
GI:22035629 PDB 2PNO 156 Chain D, Crystal Structure Of Human Leukotriene C4 Synthase
GI:22035629 PDB 2PNO 156 Chain E, Crystal Structure Of Human Leukotriene C4 Synthase
GI:22035629 PDB 2PNO 156 Chain F, Crystal Structure Of Human Leukotriene C4 Synthase