Gene/Proteome Database (LMPD)
LMPD ID
LMP002537
Gene ID
Species
Homo sapiens (Human)
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4
Gene Symbol
Synonyms
1-AGPAT4; LPAAT-delta; dJ473J16.2
Alternate Names
1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-AGPAT 4; 1-AGP acyltransferase 4; lysophosphatidic acid acyltransferase delta; lysophosphatidic acid acyltransferase-delta (LPAAT-delta); 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
Chromosome
6
Map Location
6q26
EC Number
2.3.1.51
Summary
This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| 1-acyl-sn-glycerol-3-phosphate acyltransferase delta | |
|---|---|
| Refseq ID | NP_064518 |
| Protein GI | 9910392 |
| UniProt ID | Q9NRZ5 |
| mRNA ID | NM_020133 |
| Length | 378 |
| RefSeq Status | REVIEWED |
| MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND | |
Gene Information
Entrez Gene ID
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003841 | NAS:UniProtKB | F | 1-acylglycerol-3-phosphate O-acyltransferase activity |
| GO:0016024 | IEA:UniProtKB-UniPathway | P | CDP-diacylglycerol biosynthetic process |
| GO:0044255 | TAS:Reactome | P | cellular lipid metabolic process |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0006654 | TAS:Reactome | P | phosphatidic acid biosynthetic process |
| GO:0008654 | NAS:UniProtKB | P | phospholipid biosynthetic process |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0019432 | TAS:Reactome | P | triglyceride biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00561 | Glycerolipid metabolism |
| hsa00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_120906 | Synthesis of PA |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4
Protein Entry
PLCD_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NRZ5-1; Sequence=Displayed; Name=2; IsoId=Q9NRZ5-2; Sequence=VSP_056928, VSP_056929; Note=No experimental confirmation available; |
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate. |
| Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. |
| Function | Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. |
| Interaction | P46108:CRK; NbExp=1; IntAct=EBI-1754287, EBI-886; |
| Pathway | Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3. |
| Similarity | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Widely expressed with highest levels in skeletal muscle, followed by heart, liver, prostate and thymus. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002537 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 9910392 | RefSeq | NP_064518 | 378 | 1-acyl-sn-glycerol-3-phosphate acyltransferase delta |
Identical Sequences to LMP002537 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:9910392 | GenBank | ADL85806.1 | 378 | Sequence 420 from patent US 7704496 |
| GI:9910392 | GenBank | ADL95891.1 | 378 | Sequence 420 from patent US 7718173 |
| GI:9910392 | GenBank | AFL59770.1 | 378 | Sequence 420 from patent US 8106156 |
| GI:9910392 | GenBank | AHD72053.1 | 378 | Sequence 7551 from patent US 8586006 |
| GI:9910392 | RefSeq | XP_006715575.1 | 378 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta isoform X5 [Homo sapiens] |
| GI:9910392 | RefSeq | XP_006715576.1 | 378 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta isoform X6 [Homo sapiens] |
Related Sequences to LMP002537 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:9910392 | GenBank | JAA01612.1 | 378 | 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Pan troglodytes] |
| GI:9910392 | GenBank | JAA13651.1 | 378 | 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Pan troglodytes] |
| GI:9910392 | GenBank | JAA25779.1 | 378 | 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Pan troglodytes] |
| GI:9910392 | GenBank | JAA40740.1 | 378 | 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Pan troglodytes] |
| GI:9910392 | RefSeq | XP_008971881.1 | 378 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta [Pan paniscus] |
| GI:9910392 | RefSeq | XP_008971882.1 | 378 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta [Pan paniscus] |