Gene/Proteome Database (LMPD)

LMPD ID
LMP002559
Gene ID
2880
Species
Homo sapiens (Human)
Gene Name
glutathione peroxidase 5
Gene Symbol
GPX5
Synonyms
HEL-S-75p
Alternate Names
epididymal secretory glutathione peroxidase; EGLP; GPx-5; GSHPx-5; epididymal androgen-related protein; epididymis secretory sperm binding protein Li 75p; epididymis-specific glutathione peroxidase-like protein
Chromosome
6
Map Location
6p22.1
EC Number
1.11.1.9
Summary
This gene belongs to the glutathione peroxidase family. It is specifically expressed in the epididymis in the mammalian male reproductive tract, and is androgen-regulated. Unlike mRNAs for other characterized glutathione peroxidases, this mRNA does not contain a selenocysteine (UGA) codon. Thus, the encoded protein is selenium-independent, and has been proposed to play a role in protecting the membranes of spermatozoa from the damaging effects of lipid peroxidation and/or preventing premature acrosome reaction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2008]
Orthologs
View orthologs and multiple alignments for GPX5

Proteins

epididymal secretory glutathione peroxidase isoform 1 precursor
Refseq ID NP_001500
Protein GI 4557629
UniProt ID O75715
mRNA ID NM_001509
Length 221
RefSeq Status REVIEWED
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLKYVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK
epididymal secretory glutathione peroxidase isoform 2 precursor
Refseq ID NP_003987
Protein GI 6715602
UniProt ID O75715
mRNA ID NM_003996
Length 100
RefSeq Status REVIEWED
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
sig_peptide: 1..21 calculated_mol_wt: 2397 peptide sequence: MTTQLRVVHLLPLLLACFVQT mat_peptide: 22..221 product: epididymal secretory glutathione peroxidase isoform 1 calculated_mol_wt: 22823 peptide sequence: SPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLKYVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK sig_peptide: 1..21 calculated_mol_wt: 2397 peptide sequence: MTTQLRVVHLLPLLLACFVQT mat_peptide: 22..100 product: epididymal secretory glutathione peroxidase isoform 2 calculated_mol_wt: 9050 peptide sequence: SPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM

Gene Information

Entrez Gene ID
2880
Gene Name
glutathione peroxidase 5
Gene Symbol
GPX5
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0004602 IEA:UniProtKB-EC F glutathione peroxidase activity
GO:0006629 NAS:ProtInc P lipid metabolic process
GO:0006979 IEA:InterPro P response to oxidative stress

KEGG Pathway Links

KEGG Pathway ID Description
hsa00590 Arachidonic acid metabolism
hsa00480 Glutathione metabolism
hsa04918 Thyroid hormone synthesis
ko04918 Thyroid hormone synthesis

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 5
Protein Entry
GPX5_HUMAN
UniProt ID
O75715
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O75715-1; Sequence=Displayed; Name=2; IsoId=O75715-2; Sequence=VSP_043046; Note=No experimental confirmation available.;
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Function Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Similarity Belongs to the glutathione peroxidase family.
Subcellular Location Secreted.
Tissue Specificity Epididymis.
Web Resource Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/gpx5/";

Identical and Related Proteins

Unique RefSeq proteins for LMP002559 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4557629 RefSeq NP_001500 221 epididymal secretory glutathione peroxidase isoform 1 precursor
6715602 RefSeq NP_003987 100 epididymal secretory glutathione peroxidase isoform 2 precursor

Identical Sequences to LMP002559 proteins

Reference Database Accession Length Protein Name
GI:4557629 DBBJ BAG73205.1 221 glutathione peroxidase 5, partial [synthetic construct]
GI:4557629 GenBank AAI11376.1 221 GPX5 protein, partial [synthetic construct]
GI:6715602 GenBank AAI28161.1 100 Glutathione peroxidase 5 (epididymal androgen-related protein) [Homo sapiens]
GI:6715602 GenBank AAI28160.1 100 Glutathione peroxidase 5 (epididymal androgen-related protein) [Homo sapiens]
GI:6715602 GenBank EAX03168.1 100 glutathione peroxidase 5 (epididymal androgen-related protein), isoform CRA_a [Homo sapiens]
GI:4557629 GenBank EAX03169.1 221 glutathione peroxidase 5 (epididymal androgen-related protein), isoform CRA_b [Homo sapiens]
GI:4557629 GenBank ACM84340.1 221 Sequence 9838 from patent US 6812339
GI:4557629 GenBank ACM84341.1 221 Sequence 9839 from patent US 6812339
GI:4557629 GenBank ACS44651.1 221 epididymis secretory sperm binding protein Li 75p [Homo sapiens]
GI:6715602 RefSeq NP_001243159.1 100 glutathione peroxidase 5 precursor [Pan troglodytes]

Related Sequences to LMP002559 proteins

Reference Database Accession Length Protein Name
GI:4557629 EMBL CAA44273.1 221 epididymal secretory glutathione peroxidase [Macaca fascicularis]
GI:4557629 GenBank EHH18089.1 221 Epididymal secretory glutathione peroxidase [Macaca mulatta]
GI:4557629 GenBank EHH52846.1 221 Epididymal secretory glutathione peroxidase [Macaca fascicularis]
GI:4557629 RefSeq NP_001152774.1 221 epididymal secretory glutathione peroxidase precursor [Macaca mulatta]
GI:4557629 RefSeq XP_002816641.1 221 PREDICTED: epididymal secretory glutathione peroxidase isoform X1 [Pongo abelii]
GI:6715602 RefSeq XP_003272045.1 100 PREDICTED: epididymal secretory glutathione peroxidase isoform 2 [Nomascus leucogenys]
GI:6715602 RefSeq XP_005553770.1 100 PREDICTED: epididymal secretory glutathione peroxidase isoform X2 [Macaca fascicularis]
GI:6715602 RefSeq XP_008992006.1 100 PREDICTED: epididymal secretory glutathione peroxidase isoform X2 [Callithrix jacchus]
GI:6715602 RefSeq XP_009202939.1 100 PREDICTED: epididymal secretory glutathione peroxidase isoform X2 [Papio anubis]
GI:6715602 RefSeq XP_009239843.1 100 PREDICTED: epididymal secretory glutathione peroxidase isoform X2 [Pongo abelii]
GI:6715602 RefSeq XP_010375558.1 100 PREDICTED: epididymal secretory glutathione peroxidase isoform X2 [Rhinopithecus roxellana]
GI:4557629 SwissProt P28714.1 221 RecName: Full=Epididymal secretory glutathione peroxidase; AltName: Full=Epididymis-specific glutathione peroxidase-like protein; Short=EGLP; AltName: Full=Glutathione peroxidase 5; Short=GPx-5; Short=GSHPx-5; Flags: Precursor [Macaca fascicularis]