Gene/Proteome Database (LMPD)

LMPD ID
LMP002566
Gene ID
2173
Species
Homo sapiens (Human)
Gene Name
fatty acid binding protein 7, brain
Gene Symbol
FABP7
Synonyms
B-FABP; BLBP; FABPB; LTR2-FABP7; MRG
Alternate Names
fatty acid-binding protein, brain; brain lipid binding protein; brain lipid-binding protein; fatty acid-binding protein 7; Hypothetical protein DKFZp547J2313; brain-type fatty acid-binding protein; mammary-derived growth inhibitor related; mammary-derived growth inhibitor-related
Chromosome
6
Map Location
6q22-q23
Summary
The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for FABP7

Proteins

fatty acid-binding protein, brain
Refseq ID NP_001437
Protein GI 4557585
UniProt ID O15540
mRNA ID NM_001446
Length 132
RefSeq Status REVIEWED
MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

Gene Information

Entrez Gene ID
2173
Gene Name
fatty acid binding protein 7, brain
Gene Symbol
FABP7
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042995 IEA:Ensembl C cell projection
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0043025 IEA:Ensembl C neuronal cell body
GO:0005634 IEA:Ensembl C nucleus
GO:0008289 TAS:ProtInc F lipid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0021846 IEA:Ensembl P cell proliferation in forebrain
GO:0050673 IEA:Ensembl P epithelial cell proliferation
GO:0008285 TAS:ProtInc P negative regulation of cell proliferation
GO:0007399 TAS:ProtInc P nervous system development
GO:0022008 IEA:Ensembl P neurogenesis
GO:0060134 IEA:Ensembl P prepulse inhibition

KEGG Pathway Links

KEGG Pathway ID Description
hsa03320 PPAR signaling pathway
ko03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 7, brain
Protein Entry
FABP7_HUMAN
UniProt ID
O15540
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O15540-1; Sequence=Displayed; Name=2; IsoId=O15540-2; Sequence=VSP_055490;
Domain Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
Function B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers (By similarity).
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Subcellular Location Cytoplasm.
Tissue Specificity Expressed in brain and other neural tissues.

Identical and Related Proteins

Unique RefSeq proteins for LMP002566 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4557585 RefSeq NP_001437 132 fatty acid-binding protein, brain

Identical Sequences to LMP002566 proteins

Reference Database Accession Length Protein Name
GI:4557585 DBBJ BAG34808.1 132 unnamed protein product [Homo sapiens]
GI:4557585 EMBL CAV33163.1 132 unnamed protein product [Homo sapiens]
GI:4557585 GenBank ADL88096.1 132 Sequence 132 from patent US 7705120
GI:4557585 GenBank AFK98789.1 132 Sequence 29 from patent US 8163289
GI:4557585 GenBank AHD72734.1 132 Sequence 9802 from patent US 8586006
GI:4557585 GenBank AIC48732.1 132 FABP7, partial [synthetic construct]

Related Sequences to LMP002566 proteins

Reference Database Accession Length Protein Name
GI:4557585 DBBJ BAA23324.1 132 fatty acid binding protein [Homo sapiens]
GI:4557585 EMBL CAG33338.1 132 FABP7 [Homo sapiens]
GI:4557585 EMBL CAV33167.1 163 unnamed protein product [synthetic construct]
GI:4557585 EMBL CAV33169.1 139 unnamed protein product [synthetic construct]
GI:4557585 GenBank ACM81576.1 138 Sequence 7074 from patent US 6812339
GI:4557585 PDB 1FDQ 131 Chain B, Crystal Structure Of Human Brain Fatty Acid Binding Protein