Gene/Proteome Database (LMPD)
LMPD ID
LMP002592
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Gene Symbol
Synonyms
3110030E07Rik; AW212108
Alternate Names
phosphatidylinositol N-acetylglucosaminyltransferase subunit C; PIG-C; phosphatidylinositol-glycan biosynthesis class C protein
Chromosome
1
Map Location
1 H2.1|1
EC Number
2.4.1.198
Proteins
| phosphatidylinositol N-acetylglucosaminyltransferase subunit C | |
|---|---|
| Refseq ID | NP_080354 |
| Protein GI | 21313016 |
| UniProt ID | Q9CXR4 |
| mRNA ID | NM_026078 |
| Length | 297 |
| RefSeq Status | VALIDATED |
| MCAQRVTDTPEVKWQKVLYERQPFPDNYVDQRFLEELRKNIYARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPQWLFGTGLASSLVGYVLFDLIDGGDGRKKSGRTRWADLKSTLVFITFTYGFSPVLKTLTESVSTDTIYAMAVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKAYTPRSYVGVTLLFAFSAFGGLLSISAVGAILFALLLFSISCLCPYYLIHLQLFKENIHGPWDEAEIKEDLSRFLS | |
| phosphatidylinositol N-acetylglucosaminyltransferase subunit C | |
|---|---|
| Refseq ID | NP_001034134 |
| Protein GI | 84794578 |
| UniProt ID | Q9CXR4 |
| mRNA ID | NM_001039045 |
| Length | 297 |
| RefSeq Status | VALIDATED |
| Protein sequence is identical to GI:21313016 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000506 | IEA:Ensembl | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0017176 | IEA:UniProtKB-EC | F | phosphatidylinositol N-acetylglucosaminyltransferase activity |
| GO:0006506 | IEA:UniProtKB-UniPathway | P | GPI anchor biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| mmu00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| mmu01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5893244 | Synthesis of glycosylphosphatidylinositol (GPI) |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR009450 | Phosphatidylinositol N-acetylglucosaminyltransferase subunit C |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Protein Entry
PIGC_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-D-glucosamine + 1-phosphatidyl- 1D-myo-inositol = UDP + 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol. |
| Function | Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. {ECO:0000250}. |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
| Similarity | Belongs to the PIGC family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Subunit | Associates with PIGA, PIGH, PIGP, PIGQ and DPM2. The latter is not essential for activity (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002592 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 21313016 | RefSeq | NP_080354 | 297 | phosphatidylinositol N-acetylglucosaminyltransferase subunit C |
Identical Sequences to LMP002592 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21313016 | DBBJ | BAE31396.1 | 297 | unnamed protein product [Mus musculus] |
| GI:21313016 | GenBank | AAH06938.1 | 297 | Phosphatidylinositol glycan anchor biosynthesis, class C [Mus musculus] |
| GI:21313016 | GenBank | EDL39307.1 | 297 | phosphatidylinositol glycan anchor biosynthesis, class C, isoform CRA_b [Mus musculus] |
| GI:21313016 | RefSeq | NP_001034134.1 | 297 | phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Mus musculus] |
| GI:21313016 | RefSeq | XP_006497022.1 | 297 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform X1 [Mus musculus] |
| GI:21313016 | SwissProt | Q9CXR4.1 | 297 | RecName: Full=Phosphatidylinositol N-acetylglucosaminyltransferase subunit C; AltName: Full=Phosphatidylinositol-glycan biosynthesis class C protein; Short=PIG-C [Mus musculus] |
Related Sequences to LMP002592 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21313016 | DBBJ | BAE41600.1 | 297 | unnamed protein product [Mus musculus] |
| GI:21313016 | DBBJ | BAE33529.1 | 297 | unnamed protein product [Mus musculus] |
| GI:21313016 | GenBank | AAH87080.1 | 297 | Phosphatidylinositol glycan anchor biosynthesis, class C [Rattus norvegicus] |
| GI:21313016 | GenBank | EDL39306.1 | 302 | phosphatidylinositol glycan anchor biosynthesis, class C, isoform CRA_a, partial [Mus musculus] |
| GI:21313016 | RefSeq | XP_006250244.1 | 297 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform X1 [Rattus norvegicus] |
| GI:21313016 | RefSeq | XP_006250245.1 | 297 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform X1 [Rattus norvegicus] |