Gene/Proteome Database (LMPD)

LMPD ID
LMP002620
Gene ID
Species
Homo sapiens (Human)
Gene Name
retinol binding protein 2, cellular
Gene Symbol
Synonyms
CRABP-II; CRBP2; CRBPII; RBPC2
Alternate Names
retinol-binding protein 2; CRBP-II; cellular retinol-binding protein II; retinol-binding protein 2, cellular
Chromosome
3
Map Location
3q23
Summary
RBP2 is an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. RBP2 may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

retinol-binding protein 2
Refseq ID NP_004155
Protein GI 40354214
UniProt ID P50120
mRNA ID NM_004164
Length 134
RefSeq Status REVIEWED
MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

Gene Information

Entrez Gene ID
Gene Name
retinol binding protein 2, cellular
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:Reactome C cytosol
GO:0016918 IEA:UniProtKB-KW F retinal binding
GO:0005501 TAS:ProtInc F retinoid binding
GO:0019841 IEA:UniProtKB-KW F retinol binding
GO:0005215 IEA:InterPro F transporter activity
GO:0008544 TAS:ProtInc P epidermis development
GO:0007603 TAS:Reactome P phototransduction, visible light
GO:0001523 TAS:Reactome P retinoid metabolic process
GO:0006776 TAS:ProtInc P vitamin A metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04977 Vitamin digestion and absorption

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_24968 Retinoid metabolism and transport
REACT_160125 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
retinol binding protein 2, cellular
Protein Entry
RET2_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
Function Intracellular transport of retinol.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Subcellular Location Cytoplasm.
Tissue Specificity Higher expression in adult small intestine and to a much lesser extent in fetal kidney.

Identical and Related Proteins

Unique RefSeq proteins for LMP002620 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
40354214 RefSeq NP_004155 134 retinol-binding protein 2

Identical Sequences to LMP002620 proteins

Reference Database Accession Length Protein Name
GI:40354214 DBBJ BAI45846.1 134 retinol binding protein 2, cellular, partial [synthetic construct]
GI:40354214 GenBank ADQ32877.1 134 retinol binding protein 2, cellular, partial [synthetic construct]
GI:40354214 GenBank AHD78097.1 134 Sequence 25076 from patent US 8586006
GI:40354214 GenBank AIC55025.1 134 RBP2, partial [synthetic construct]
GI:40354214 RefSeq XP_005247750.1 134 PREDICTED: retinol-binding protein 2 isoform X1 [Homo sapiens]
GI:40354214 RefSeq XP_006713785.1 134 PREDICTED: retinol-binding protein 2 isoform X2 [Homo sapiens]

Related Sequences to LMP002620 proteins

Reference Database Accession Length Protein Name
GI:40354214 GenBank AAC50162.1 134 cellular retinol binding protein II [Homo sapiens]
GI:40354214 GenBank AAE27635.1 134 Sequence 5 from patent US 5955305
GI:40354214 GenBank AAE34442.1 134 Sequence 9 from patent US 5977309
GI:40354214 PDB 2RCQ 141 Chain A, Crystal Strucure Of Human Apo Cellular Retinol Binding Protein Ii (Crbp-Ii)
GI:40354214 PDB 2RCT 141 Chain A, Crystal Structure Of Human Holo Cellular Retinol-Binding Protein Ii (Crbp-Ii)
GI:40354214 RefSeq XP_003265352.1 134 PREDICTED: retinol-binding protein 2 [Nomascus leucogenys]