Gene/Proteome Database (LMPD)
LMPD ID
LMP002628
Gene ID
Species
Homo sapiens (Human)
Gene Name
sphingosine-1-phosphate receptor 1
Gene Symbol
Synonyms
CD363; CHEDG1; D1S3362; ECGF1; EDG-1; EDG1; S1P1
Alternate Names
sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P receptor Edg-1; sphingosine 1-phosphate receptor EDG1; sphingosine 1-phosphate receptor Edg-1; endothelial differentiation G-protein coupled receptor 1; endothelial differentiation, sphingolipid G-protein-coupled receptor, 1
Chromosome
1
Map Location
1p21
Summary
The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| sphingosine 1-phosphate receptor 1 | |
|---|---|
| Refseq ID | NP_001391 |
| Protein GI | 13027636 |
| UniProt ID | P21453 |
| mRNA ID | NM_001400 |
| Length | 382 |
| RefSeq Status | REVIEWED |
| MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS | |
Gene Information
Entrez Gene ID
Gene Name
sphingosine-1-phosphate receptor 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005768 | IEA:UniProtKB-KW | C | endosome |
| GO:0009897 | IEA:Ensembl | C | external side of plasma membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0031226 | IDA:UniProtKB | C | intrinsic component of plasma membrane |
| GO:0005886 | TAS:Reactome | C | plasma membrane |
| GO:0004930 | TAS:ProtInc | F | G-protein coupled receptor activity |
| GO:0001664 | IPI:UniProtKB | F | G-protein coupled receptor binding |
| GO:0046625 | IEA:Ensembl | F | sphingolipid binding |
| GO:0038036 | IDA:UniProtKB | F | sphingosine-1-phosphate receptor activity |
| GO:0007186 | TAS:ProtInc | P | G-protein coupled receptor signaling pathway |
| GO:0072678 | ISS:UniProtKB | P | T cell migration |
| GO:0031532 | ISS:UniProtKB | P | actin cytoskeleton reorganization |
| GO:0007193 | IEA:Ensembl | P | adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway |
| GO:0001525 | IEA:UniProtKB-KW | P | angiogenesis |
| GO:0001955 | ISS:UniProtKB | P | blood vessel maturation |
| GO:0007420 | IEA:Ensembl | P | brain development |
| GO:0003245 | ISS:UniProtKB | P | cardiac muscle tissue growth involved in heart morphogenesis |
| GO:0007155 | TAS:ProtInc | P | cell adhesion |
| GO:0016477 | ISS:UniProtKB | P | cell migration |
| GO:0006935 | ISS:UniProtKB | P | chemotaxis |
| GO:0045446 | IEA:Ensembl | P | endothelial cell differentiation |
| GO:0061384 | ISS:UniProtKB | P | heart trabecula morphogenesis |
| GO:0030032 | ISS:UniProtKB | P | lamellipodium assembly |
| GO:0051497 | IEA:Ensembl | P | negative regulation of stress fiber assembly |
| GO:0030182 | IEA:Ensembl | P | neuron differentiation |
| GO:0032320 | IEA:Ensembl | P | positive regulation of Ras GTPase activity |
| GO:0030335 | IEA:Ensembl | P | positive regulation of cell migration |
| GO:0051482 | IEA:Ensembl | P | positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway |
| GO:0050927 | IEA:Ensembl | P | positive regulation of positive chemotaxis |
| GO:0048661 | IEA:Ensembl | P | positive regulation of smooth muscle cell proliferation |
| GO:0045944 | IEA:Ensembl | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0030500 | ISS:UniProtKB | P | regulation of bone mineralization |
| GO:0045124 | ISS:UniProtKB | P | regulation of bone resorption |
| GO:0030155 | IEA:Ensembl | P | regulation of cell adhesion |
| GO:0003376 | IDA:UniProtKB | P | sphingosine-1-phosphate signaling pathway |
| GO:0019226 | IEA:Ensembl | P | transmission of nerve impulse |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04068 | FoxO signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_19231 | G alpha (i) signalling events |
Domain Information
UniProt Annotations
Entry Information
Gene Name
sphingosine-1-phosphate receptor 1
Protein Entry
S1PR1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis (By similarity). Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3- phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury. {ECO |
| Induction | By the tumor promoter phorbol 12-myristate 13-acetate (PMA) in the presence of cycloheximide. |
| Ptm | S1P-induced endothelial cell migration requires the PKB/AKT1- mediated phosphorylation of the third intracellular loop at the Thr-236 residue. {ECO |
| Similarity | Belongs to the G-protein coupled receptor 1 family. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. Endosome. Membrane raft. Note=Recruited to caveolin-enriched plasma membrane microdomains in response to oxidized 1-palmitoyl- 2-arachidonoyl-sn-glycero-3-phosphocholine. Ligand binding leads to receptor internalization. |
| Subunit | Interacts with GNAI1 and GNAI3. |
| Tissue Specificity | Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002628 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 13027636 | RefSeq | NP_001391 | 382 | sphingosine 1-phosphate receptor 1 |
Identical Sequences to LMP002628 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13027636 | GenBank | ADF24393.1 | 382 | Sequence 31 from patent US 7691563 |
| GI:13027636 | GenBank | AED45322.1 | 382 | Sequence 786 from patent US 7892730 |
| GI:13027636 | GenBank | AEU56593.1 | 382 | Sequence 105 from patent US 8067189 |
| GI:13027636 | GenBank | AHD70803.1 | 382 | Sequence 4271 from patent US 8586006 |
| GI:13027636 | GenBank | AIC48672.1 | 382 | S1PR1, partial [synthetic construct] |
| GI:13027636 | RefSeq | XP_006710462.1 | 382 | PREDICTED: sphingosine 1-phosphate receptor 1 isoform X1 [Homo sapiens] |
Related Sequences to LMP002628 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13027636 | GenBank | AAU98835.1 | 381 | Sequence 19 from patent US 6730663 |
| GI:13027636 | GenBank | AAX29856.1 | 383 | endothelial differentiation sphingolipid G-protein-coupled receptor 1, partial [synthetic construct] |
| GI:13027636 | GenBank | AAX36974.1 | 383 | endothelial differentiation sphingolipid G-protein-coupled receptor 1, partial [synthetic construct] |
| GI:13027636 | RefSeq | XP_001138918.1 | 382 | PREDICTED: sphingosine 1-phosphate receptor 1 [Pan troglodytes] |
| GI:13027636 | RefSeq | XP_002690742.2 | 312 | PREDICTED: olfactory receptor 4K13 [Bos taurus] |
| GI:13027636 | RefSeq | XP_004026264.1 | 382 | PREDICTED: sphingosine 1-phosphate receptor 1 isoform 1 [Gorilla gorilla gorilla] |