Gene/Proteome Database (LMPD)
LMPD ID
LMP002651
Gene ID
Species
Homo sapiens (Human)
Gene Name
low density lipoprotein receptor-related protein associated protein 1
Gene Symbol
Synonyms
A2MRAP; A2RAP; HBP44; MRAP; MYP23; RAP; alpha-2-MRAP
Alternate Names
alpha-2-macroglobulin receptor-associated protein; 39 kDa receptor-associated protein; low density lipoprotein-related protein-associated protein 1 (alpha-2-macroglobulin receptor-associated protein 1)
Chromosome
4
Map Location
4p16.3
Summary
This gene encodes a protein that interacts with the low density lipoprotein (LDL) receptor-related protein and facilitates its proper folding and localization by preventing the binding of ligands. Mutations in this gene have been identified in individuals with myopia 23. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
Orthologs
Proteins
| alpha-2-macroglobulin receptor-associated protein precursor | |
|---|---|
| Refseq ID | NP_002328 |
| Protein GI | 4505021 |
| UniProt ID | P30533 |
| mRNA ID | NM_002337 |
| Length | 357 |
| RefSeq Status | REVIEWED |
| MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL | |
| sig_peptide: 1..30 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3333 peptide sequence: MAPRRVRSFLRGLPALLLLLLFLGPWPAAS | |
Gene Information
Entrez Gene ID
Gene Name
low density lipoprotein receptor-related protein associated protein 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:HPA | C | endoplasmic reticulum |
| GO:0005576 | IDA:GOC | C | extracellular region |
| GO:0016021 | TAS:ProtInc | C | integral component of membrane |
| GO:0005886 | IDA:MGI | C | plasma membrane |
| GO:0048237 | IEA:Ensembl | C | rough endoplasmic reticulum lumen |
| GO:0031982 | IEA:Ensembl | C | vesicle |
| GO:0004873 | TAS:ProtInc | F | asialoglycoprotein receptor activity |
| GO:0008201 | TAS:ProtInc | F | heparin binding |
| GO:0050750 | IDA:MGI | F | low-density lipoprotein particle receptor binding |
| GO:0048019 | IDA:BHF-UCL | F | receptor antagonist activity |
| GO:0051082 | TAS:ProtInc | F | unfolded protein binding |
| GO:0070326 | IPI:BHF-UCL | F | very-low-density lipoprotein particle receptor binding |
| GO:1900116 | IDA:GOC | P | extracellular negative regulation of signal transduction |
| GO:1900222 | IGI:BHF-UCL | P | negative regulation of beta-amyloid clearance |
| GO:0032091 | IDA:BHF-UCL | P | negative regulation of protein binding |
| GO:0010916 | IDA:BHF-UCL | P | negative regulation of very-low-density lipoprotein particle clearance |
| GO:0006457 | TAS:ProtInc | P | protein folding |
| GO:0006898 | TAS:GOC | P | receptor-mediated endocytosis |
| GO:0016192 | TAS:ProtInc | P | vesicle-mediated transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
low density lipoprotein receptor-related protein associated protein 1
Protein Entry
AMRP_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Disease | Myopia 23, autosomal recessive (MYP23) [MIM |
| Disease | Note=In complex with the alpha-2-MR or gp330, it may have some role in the pathogenesis of membrane glomerular nephritis. |
| Function | Interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330. |
| Interaction | P98155:VLDLR; NbExp=4; IntAct=EBI-715927, EBI-9004309; |
| Ptm | N-glycosylated. {ECO |
| Similarity | Belongs to the alpha-2-MRAP family. |
| Subcellular Location | Endoplasmic reticulum. Cytoplasm. Cell surface. Note=Intracellular and associated with cell surface receptors. Found in the endoplasmic reticulum. |
| Subunit | Present on cell surface forming a complex with the alpha- 2-macroglobulin receptor heavy and light chains. Binds LRP1B; binding is followed by internalization and degradation. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002651 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4505021 | RefSeq | NP_002328 | 357 | alpha-2-macroglobulin receptor-associated protein precursor |
Identical Sequences to LMP002651 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4505021 | GenBank | AED39383.1 | 357 | Sequence 1543 from patent US 7883858 |
| GI:4505021 | GenBank | AEU55868.1 | 357 | Sequence 12 from patent US 8066997 |
| GI:4505021 | GenBank | AGM72543.1 | 357 | Sequence 13 from patent US 8377701 |
| GI:4505021 | GenBank | AGN07048.1 | 357 | Sequence 2 from patent US 8440629 |
| GI:4505021 | GenBank | AHD75876.1 | 357 | Sequence 18259 from patent US 8586006 |
| GI:4505021 | GenBank | AIC49142.1 | 357 | LRPAP1, partial [synthetic construct] |
Related Sequences to LMP002651 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4505021 | DBBJ | BAD96224.1 | 357 | low density lipoprotein receptor-related protein associated protein 1 variant, partial [Homo sapiens] |
| GI:4505021 | GenBank | AAY18903.1 | 381 | lipoprotein receptor associated protein; alpha-2-macroglobulin receptor-associated protein [synthetic construct] |
| GI:4505021 | GenBank | ACP57138.1 | 682 | Sequence 1267 from patent US 7482117 |
| GI:4505021 | GenBank | ACP57139.1 | 682 | Sequence 1268 from patent US 7482117 |
| GI:4505021 | GenBank | ADS30735.1 | 682 | Sequence 1267 from patent US 7781168 |
| GI:4505021 | GenBank | ADS30736.1 | 682 | Sequence 1268 from patent US 7781168 |