Gene/Proteome Database (LMPD)

LMPD ID
LMP002651
Gene ID
Species
Homo sapiens (Human)
Gene Name
low density lipoprotein receptor-related protein associated protein 1
Gene Symbol
Synonyms
A2MRAP; A2RAP; HBP44; MRAP; MYP23; RAP; alpha-2-MRAP
Alternate Names
alpha-2-macroglobulin receptor-associated protein; 39 kDa receptor-associated protein; low density lipoprotein-related protein-associated protein 1 (alpha-2-macroglobulin receptor-associated protein 1)
Chromosome
4
Map Location
4p16.3
Summary
This gene encodes a protein that interacts with the low density lipoprotein (LDL) receptor-related protein and facilitates its proper folding and localization by preventing the binding of ligands. Mutations in this gene have been identified in individuals with myopia 23. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
Orthologs

Proteins

alpha-2-macroglobulin receptor-associated protein precursor
Refseq ID NP_002328
Protein GI 4505021
UniProt ID P30533
mRNA ID NM_002337
Length 357
RefSeq Status REVIEWED
MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL
sig_peptide: 1..30 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3333 peptide sequence: MAPRRVRSFLRGLPALLLLLLFLGPWPAAS

Gene Information

Entrez Gene ID
Gene Name
low density lipoprotein receptor-related protein associated protein 1
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:HPA C endoplasmic reticulum
GO:0005576 IDA:GOC C extracellular region
GO:0016021 TAS:ProtInc C integral component of membrane
GO:0005886 IDA:MGI C plasma membrane
GO:0048237 IEA:Ensembl C rough endoplasmic reticulum lumen
GO:0031982 IEA:Ensembl C vesicle
GO:0004873 TAS:ProtInc F asialoglycoprotein receptor activity
GO:0008201 TAS:ProtInc F heparin binding
GO:0050750 IDA:MGI F low-density lipoprotein particle receptor binding
GO:0048019 IDA:BHF-UCL F receptor antagonist activity
GO:0051082 TAS:ProtInc F unfolded protein binding
GO:0070326 IPI:BHF-UCL F very-low-density lipoprotein particle receptor binding
GO:1900116 IDA:GOC P extracellular negative regulation of signal transduction
GO:1900222 IGI:BHF-UCL P negative regulation of beta-amyloid clearance
GO:0032091 IDA:BHF-UCL P negative regulation of protein binding
GO:0010916 IDA:BHF-UCL P negative regulation of very-low-density lipoprotein particle clearance
GO:0006457 TAS:ProtInc P protein folding
GO:0006898 TAS:GOC P receptor-mediated endocytosis
GO:0016192 TAS:ProtInc P vesicle-mediated transport

Domain Information

InterPro Annotations

Accession Description
IPR010483 Alpha-2-macroglobulin RAP, C-terminal
IPR009066 Alpha-2-macroglobulin receptor-associated protein, domain 1

UniProt Annotations

Entry Information

Gene Name
low density lipoprotein receptor-related protein associated protein 1
Protein Entry
AMRP_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Disease Myopia 23, autosomal recessive (MYP23) [MIM
Disease Note=In complex with the alpha-2-MR or gp330, it may have some role in the pathogenesis of membrane glomerular nephritis.
Function Interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330.
Interaction P98155:VLDLR; NbExp=4; IntAct=EBI-715927, EBI-9004309;
Ptm N-glycosylated. {ECO
Similarity Belongs to the alpha-2-MRAP family.
Subcellular Location Endoplasmic reticulum. Cytoplasm. Cell surface. Note=Intracellular and associated with cell surface receptors. Found in the endoplasmic reticulum.
Subunit Present on cell surface forming a complex with the alpha- 2-macroglobulin receptor heavy and light chains. Binds LRP1B; binding is followed by internalization and degradation.

Identical and Related Proteins

Unique RefSeq proteins for LMP002651 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4505021 RefSeq NP_002328 357 alpha-2-macroglobulin receptor-associated protein precursor

Identical Sequences to LMP002651 proteins

Reference Database Accession Length Protein Name
GI:4505021 GenBank AED39383.1 357 Sequence 1543 from patent US 7883858
GI:4505021 GenBank AEU55868.1 357 Sequence 12 from patent US 8066997
GI:4505021 GenBank AGM72543.1 357 Sequence 13 from patent US 8377701
GI:4505021 GenBank AGN07048.1 357 Sequence 2 from patent US 8440629
GI:4505021 GenBank AHD75876.1 357 Sequence 18259 from patent US 8586006
GI:4505021 GenBank AIC49142.1 357 LRPAP1, partial [synthetic construct]

Related Sequences to LMP002651 proteins

Reference Database Accession Length Protein Name
GI:4505021 DBBJ BAD96224.1 357 low density lipoprotein receptor-related protein associated protein 1 variant, partial [Homo sapiens]
GI:4505021 GenBank AAY18903.1 381 lipoprotein receptor associated protein; alpha-2-macroglobulin receptor-associated protein [synthetic construct]
GI:4505021 GenBank ACP57138.1 682 Sequence 1267 from patent US 7482117
GI:4505021 GenBank ACP57139.1 682 Sequence 1268 from patent US 7482117
GI:4505021 GenBank ADS30735.1 682 Sequence 1267 from patent US 7781168
GI:4505021 GenBank ADS30736.1 682 Sequence 1268 from patent US 7781168