Gene/Proteome Database (LMPD)
Proteins
| colipase precursor | |
|---|---|
| Refseq ID | NP_079745 |
| Protein GI | 13384886 |
| UniProt ID | Q9CQC2 |
| mRNA ID | NM_025469 |
| Length | 113 |
| RefSeq Status | PROVISIONAL |
| MEKVLVLLLVSLLAVAYAAPGPRGLIINLEDGEICLNSMQCKSRCCQHDTILGIARCTHKAMENSECSPKTLYGIYYRCPCERGLTCEGDRSIIGAITNTNYGICLDSRRSKQ | |
| sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1945 peptide sequence: MEKVLVLLLVSLLAVAYA mat_peptide: 24..113 product: Colipase experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9CQC2.1) calculated_mol_wt: 10039 peptide sequence: GLIINLEDGEICLNSMQCKSRCCQHDTILGIARCTHKAMENSECSPKTLYGIYYRCPCERGLTCEGDRSIIGAITNTNYGICLDSRRSKQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0008047 | IEA:InterPro | F | enzyme activator activity |
| GO:0007586 | IEA:UniProtKB-KW | P | digestion |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko04975 | Fat digestion and absorption |
| mmu04975 | Fat digestion and absorption |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Colipase is a cofactor of pancreatic lipase. It allows the lipase to anchor itself to the lipid-water interface. Without colipase the enzyme is washed off by bile salts, which have an inhibitory effect on the lipase. |
| Function | Enterostatin has a biological activity as a satiety signal. {ECO:0000250}. |
| Similarity | Belongs to the colipase family. {ECO:0000255|PROSITE- ProRule:PRU00674}. |
| Subcellular Location | Secreted. |
| Subunit | Forms a 1:1 stoichiometric complex with pancreatic lipase. {ECO:0000255|PROSITE-ProRule:PRU00674}. |
| Tissue Specificity | Expressed by the pancreas. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002656 (as displayed in Record Overview)
Identical Sequences to LMP002656 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13384886 | DBBJ | BAC25769.1 | 113 | unnamed protein product [Mus musculus] |
| GI:13384886 | GenBank | AAL40730.1 | 113 | colipase [Mus musculus] |
| GI:13384886 | GenBank | AAL40731.1 | 113 | colipase [Mus musculus] |
| GI:13384886 | GenBank | AAH42935.1 | 113 | Colipase, pancreatic [Mus musculus] |
| GI:13384886 | GenBank | EDL22580.1 | 113 | colipase, pancreatic [Mus musculus] |
| GI:13384886 | SwissProt | Q9CQC2.1 | 113 | RecName: Full=Colipase; Flags: Precursor [Mus musculus] |
Related Sequences to LMP002656 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13384886 | DBBJ | BAB31505.1 | 113 | unnamed protein product [Mus musculus] |
| GI:13384886 | GenBank | AAA40943.1 | 112 | colipase [Rattus norvegicus] |
| GI:13384886 | GenBank | AAA20505.1 | 112 | colipase [Rattus norvegicus] |
| GI:13384886 | RefSeq | NP_037271.1 | 112 | colipase precursor [Rattus norvegicus] |
| GI:13384886 | RefSeq | XP_008770933.1 | 112 | PREDICTED: colipase isoform X1 [Rattus norvegicus] |
| GI:13384886 | SwissProt | P17084.2 | 112 | RecName: Full=Colipase; Flags: Precursor [Rattus norvegicus] |