Gene/Proteome Database (LMPD)
LMPD ID
LMP002662
Gene ID
Species
Mus musculus (Mouse)
Gene Name
inositol hexaphosphate kinase 2
Gene Symbol
Synonyms
1500005N04Rik; AW050208; Ihpk2
Alternate Names
inositol hexakisphosphate kinase 2; piUS; insP6 kinase 2; p(i)-uptake stimulator
Chromosome
9
Map Location
9 F2|9
EC Number
2.7.4.21
Proteins
inositol hexakisphosphate kinase 2 | |
---|---|
Refseq ID | NP_083910 |
Protein GI | 225903432 |
UniProt ID | Q80V72 |
mRNA ID | NM_029634 |
Length | 448 |
RefSeq Status | VALIDATED |
MSPAFRTMDVEPRTKGILLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRRFTPQYKAVLIFVRCADEFGASGNIETKEQGVVSVRFEEDEDRNLCLIAYPLKGDHGTVDIVDNSDCEPKSKLLRWTNKKHHALETEKNPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYSVEKKGNVSSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGTGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKEWPEVTLDSDAEDLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDSVVHEGQDAGYIFGLQSLIDIVTEISEESGE |
Gene Information
Entrez Gene ID
Gene Name
inositol hexaphosphate kinase 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0045111 | IEA:Ensembl | C | intermediate filament cytoskeleton |
GO:0005634 | IDA:UniProtKB | C | nucleus |
GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
GO:0052723 | IEA:UniProtKB-EC | F | inositol hexakisphosphate 1-kinase activity |
GO:0052724 | IEA:UniProtKB-EC | F | inositol hexakisphosphate 3-kinase activity |
GO:0000832 | IEA:UniProtKB-EC | F | inositol hexakisphosphate 5-kinase activity |
GO:0008440 | IEA:InterPro | F | inositol-1,4,5-trisphosphate 3-kinase activity |
GO:0030308 | IEA:Ensembl | P | negative regulation of cell growth |
GO:0006817 | IEA:Ensembl | P | phosphate ion transport |
GO:0046854 | IEA:Ensembl | P | phosphatidylinositol phosphorylation |
GO:0043065 | IEA:Ensembl | P | positive regulation of apoptotic process |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR005522 | Inositol polyphosphate kinase |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | ATP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6- pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate. |
Catalytic Activity | ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate. |
Function | Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Was first identified because of its ability to stimulate Na(+)-dependent phosphate cotransport (By similarity). {ECO:0000250}. |
Similarity | Belongs to the inositol phosphokinase (IPK) family. {ECO:0000305}. |
Subcellular Location | Nucleus {ECO:0000250}. |
Tissue Specificity | Highly expressed in brain and lung, and at slightly lower levels in liver, kidney and testis. {ECO:0000269|PubMed:10574768}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002662 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
225903432 | RefSeq | NP_083910 | 448 | inositol hexakisphosphate kinase 2 |
Identical Sequences to LMP002662 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:225903432 | RefSeq | XP_006511913.1 | 448 | PREDICTED: inositol hexakisphosphate kinase 2 isoform X1 [Mus musculus] |
GI:225903432 | RefSeq | XP_006511914.1 | 448 | PREDICTED: inositol hexakisphosphate kinase 2 isoform X2 [Mus musculus] |
GI:225903432 | SwissProt | Q80V72.2 | 448 | RecName: Full=Inositol hexakisphosphate kinase 2; Short=InsP6 kinase 2; AltName: Full=P(i)-uptake stimulator; Short=PiUS [Mus musculus] |
Related Sequences to LMP002662 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:225903432 | GenBank | AAH39922.1 | 448 | Inositol hexaphosphate kinase 2 [Mus musculus] |
GI:225903432 | RefSeq | XP_003504281.1 | 448 | PREDICTED: inositol hexakisphosphate kinase 2 isoform X1 [Cricetulus griseus] |
GI:225903432 | RefSeq | XP_005075012.1 | 448 | PREDICTED: inositol hexakisphosphate kinase 2 isoform X1 [Mesocricetus auratus] |
GI:225903432 | RefSeq | XP_006978359.1 | 448 | PREDICTED: inositol hexakisphosphate kinase 2 isoform X2 [Peromyscus maniculatus bairdii] |
GI:225903432 | RefSeq | XP_007632963.1 | 448 | PREDICTED: inositol hexakisphosphate kinase 2 isoform X1 [Cricetulus griseus] |
GI:225903432 | RefSeq | XP_008764788.1 | 448 | PREDICTED: inositol hexakisphosphate kinase 2 isoform X3 [Rattus norvegicus] |