Gene/Proteome Database (LMPD)
LMPD ID
LMP002714
Gene ID
Species
Homo sapiens (Human)
Gene Name
acyl-CoA thioesterase 8
Gene Symbol
Synonyms
HNAACTE; PTE-1; PTE-2; PTE1; PTE2; hACTE-III; hTE
Alternate Names
acyl-coenzyme A thioesterase 8; thioesterase II; thioesterase III; choloyl-CoA hydrolase; palmitoyl-CoA hydrolase; choloyl-coenzyme A thioesterase; long-chain fatty-acyl-CoA hydrolase; peroxisomal acyl-CoA thioesterase 1; HIV-Nef associated acyl-CoA thioesterase; peroxisomal long-chain acyl-CoA thioesterase 1; peroxisomal acyl-coenzyme A thioester hydrolase 1
Chromosome
20
Map Location
20q13.12
EC Number
3.1.2.27
Summary
The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. [provided by RefSeq, Oct 2010]
Orthologs
Proteins
| acyl-coenzyme A thioesterase 8 | |
|---|---|
| Refseq ID | NP_005460 |
| Protein GI | 34577075 |
| UniProt ID | O14734 |
| mRNA ID | NM_005469 |
| Length | 319 |
| RefSeq Status | REVIEWED |
| MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0005782 | IDA:UniProtKB | C | peroxisomal matrix |
| GO:0047617 | IDA:UniProtKB | F | acyl-CoA hydrolase activity |
| GO:0052689 | IEA:UniProtKB-KW | F | carboxylic ester hydrolase activity |
| GO:0033882 | IEA:UniProtKB-EC | F | choloyl-CoA hydrolase activity |
| GO:0052815 | IDA:UniProtKB | F | medium-chain acyl-CoA hydrolase activity |
| GO:0016290 | IDA:UniProtKB | F | palmitoyl-CoA hydrolase activity |
| GO:0005102 | IPI:UniProtKB | F | receptor binding |
| GO:0006637 | IDA:UniProtKB | P | acyl-CoA metabolic process |
| GO:0036109 | TAS:Reactome | P | alpha-linolenic acid metabolic process |
| GO:0006699 | TAS:Reactome | P | bile acid biosynthetic process |
| GO:0008206 | TAS:Reactome | P | bile acid metabolic process |
| GO:0044255 | TAS:Reactome | P | cellular lipid metabolic process |
| GO:0043649 | IDA:UniProtKB | P | dicarboxylic acid catabolic process |
| GO:0033540 | TAS:Reactome | P | fatty acid beta-oxidation using acyl-CoA oxidase |
| GO:0016559 | IDA:UniProtKB | P | peroxisome fission |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0033559 | TAS:Reactome | P | unsaturated fatty acid metabolic process |
| GO:0016032 | IEA:UniProtKB-KW | P | viral process |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121147 | alpha-linolenic acid (ALA) metabolism |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Choloyl-CoA + H(2)O = cholate + CoA. |
| Function | Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May mediate Nef-induced down-regulation of CD4. Major thioesterase in peroxisomes. Competes with BAAT (Bile acid CoA |
| Induction | Regulated by peroxisome proliferator (such as Clofibrate), via the peroxisome proliferator-activated receptors (PPARs). |
| Interaction | P04601:nef (xeno); NbExp=5; IntAct=EBI-1237371, EBI-6164028; |
| Similarity | Belongs to the C/M/P thioester hydrolase family. |
| Subcellular Location | Peroxisome. |
| Subunit | Interacts with HIV-1 Nef. |
| Tissue Specificity | Detected in a T-cell line (at protein level). Ubiquitous. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002714 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 34577075 | RefSeq | NP_005460 | 319 | acyl-coenzyme A thioesterase 8 |
Identical Sequences to LMP002714 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:34577075 | GenBank | ABA16061.1 | 319 | Sequence 4 from patent US 6914170 |
| GI:34577075 | GenBank | AAI17156.1 | 319 | Acyl-CoA thioesterase 8 [Homo sapiens] |
| GI:34577075 | GenBank | AAI17158.1 | 319 | Acyl-CoA thioesterase 8 [Homo sapiens] |
| GI:34577075 | GenBank | EAW75797.1 | 319 | acyl-CoA thioesterase 8, isoform CRA_d [Homo sapiens] |
| GI:34577075 | GenBank | ADR82946.1 | 319 | acyl-CoA thioesterase 8, partial [synthetic construct] |
| GI:34577075 | GenBank | AIC50477.1 | 319 | ACOT8, partial [synthetic construct] |
Related Sequences to LMP002714 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:34577075 | EMBL | CAG46577.1 | 319 | PTE1, partial [Homo sapiens] |
| GI:34577075 | GenBank | JAA01428.1 | 319 | acyl-CoA thioesterase 8 [Pan troglodytes] |
| GI:34577075 | GenBank | JAA14330.1 | 319 | acyl-CoA thioesterase 8 [Pan troglodytes] |
| GI:34577075 | GenBank | JAA27178.1 | 319 | acyl-CoA thioesterase 8 [Pan troglodytes] |
| GI:34577075 | RefSeq | XP_001158053.1 | 319 | PREDICTED: acyl-coenzyme A thioesterase 8 isoform X1 [Pan troglodytes] |
| GI:34577075 | RefSeq | XP_004062329.1 | 319 | PREDICTED: acyl-coenzyme A thioesterase 8 [Gorilla gorilla gorilla] |