Gene/Proteome Database (LMPD)
LMPD ID
LMP002715
Gene ID
Species
Homo sapiens (Human)
Gene Name
CDP-diacylglycerol--inositol 3-phosphatidyltransferase
Gene Symbol
Synonyms
PIS; PIS1
Chromosome
16
Map Location
16p11.2
Summary
Phosphatidylinositol breakdown products are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. Two enzymes, CDP-diacylglycerol synthase and phosphatidylinositol synthase, are involved in the biosynthesis of phosphatidylinositol. Phosphatidylinositol synthase, a member of the CDP-alcohol phosphatidyl transferase class-I family, is an integral membrane protein found on the cytoplasmic side of the endoplasmic reticulum and the Golgi apparatus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
Orthologs
Proteins
| CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform 1 | |
|---|---|
| Refseq ID | NP_006310 |
| Protein GI | 5453906 |
| UniProt ID | O14735 |
| mRNA ID | NM_006319 |
| Length | 213 |
| RefSeq Status | REVIEWED |
| MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK | |
| CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform 2 | |
|---|---|
| Refseq ID | NP_001273514 |
| Protein GI | 557440904 |
| UniProt ID | O14735 |
| mRNA ID | NM_001286585 |
| Length | 168 |
| RefSeq Status | REVIEWED |
| MPDENIFLFVPNLIGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK | |
| CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform 3 | |
|---|---|
| Refseq ID | NP_001273515 |
| Protein GI | 557440906 |
| UniProt ID | A8K3L7 |
| mRNA ID | NM_001286586 |
| Length | 148 |
| RefSeq Status | REVIEWED |
| MLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK | |
Gene Information
Entrez Gene ID
Gene Name
CDP-diacylglycerol--inositol 3-phosphatidyltransferase
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016020 | IEA:InterPro | C | membrane |
| GO:0003881 | IEA:Ensembl | F | CDP-diacylglycerol-inositol 3-phosphatidyltransferase activity |
| GO:0043178 | IEA:Ensembl | F | alcohol binding |
| GO:0030246 | IEA:Ensembl | F | carbohydrate binding |
| GO:0019992 | IEA:Ensembl | F | diacylglycerol binding |
| GO:0030145 | IEA:Ensembl | F | manganese ion binding |
| GO:0046341 | IEA:Ensembl | P | CDP-diacylglycerol metabolic process |
| GO:0006661 | IEA:Ensembl | P | phosphatidylinositol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00564 | Glycerophospholipid metabolism |
| hsa00562 | Inositol phosphate metabolism |
BIOCYC Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
CDP-diacylglycerol--inositol 3-phosphatidyltransferase
Protein Entry
A8K3L7_HUMAN
UniProt ID
Species
Human
Identical and Related Proteins
Unique RefSeq proteins for LMP002715 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 5453906 | RefSeq | NP_006310 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform 1 |
| 557440904 | RefSeq | NP_001273514 | 168 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform 2 |
| 557440906 | RefSeq | NP_001273515 | 148 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform 3 |
Identical Sequences to LMP002715 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5453906 | GenBank | JAA01654.1 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Pan troglodytes] |
| GI:5453906 | GenBank | JAA20658.1 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Pan troglodytes] |
| GI:5453906 | GenBank | JAA22207.1 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Pan troglodytes] |
| GI:5453906 | GenBank | JAA33651.1 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Pan troglodytes] |
| GI:5453906 | GenBank | AIC50616.1 | 213 | CDIPT, partial [synthetic construct] |
| GI:5453906 | RefSeq | XP_003809413.1 | 213 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform X2 [Pan paniscus] |
| GI:557440906 | RefSeq | XP_008959844.1 | 148 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform X3 [Pan paniscus] |
| GI:557440906 | RefSeq | XP_009428877.1 | 148 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform X3 [Pan troglodytes] |
Related Sequences to LMP002715 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:557440906 | DBBJ | BAF83321.1 | 213 | unnamed protein product [Homo sapiens] |
| GI:557440904 | DBBJ | BAG62462.1 | 168 | unnamed protein product [Homo sapiens] |
| GI:557440906 | GenBank | AAB94860.1 | 213 | phosphatidylinositol synthase [Homo sapiens] |
| GI:5453906 | GenBank | AAP36554.1 | 214 | Homo sapiens CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase), partial [synthetic construct] |
| GI:557440906 | GenBank | AAX32113.1 | 213 | CDP-diacylglycerol-inositol 3-phosphatidyltransferase [synthetic construct] |
| GI:557440906 | GenBank | AAX32114.1 | 213 | CDP-diacylglycerol-inositol 3-phosphatidyltransferase [synthetic construct] |
| GI:5453906 | GenBank | AAX37049.1 | 214 | CDP-diacylglycerol-inositol 3-phosphatidyltransferase, partial [synthetic construct] |
| GI:5453906 | GenBank | AAX43736.1 | 214 | CDP-diacylglycerol-inositol 3-phosphatidyltransferase, partial [synthetic construct] |
| GI:557440906 | GenBank | EAW79977.1 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase), isoform CRA_a [Homo sapiens] |
| GI:5453906 | GenBank | ACM81979.1 | 287 | Sequence 7477 from patent US 6812339 |
| GI:557440906 | RefSeq | XP_001145226.1 | 213 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform X2 [Pan troglodytes] |
| GI:557440904 | RefSeq | XP_003282035.1 | 168 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform 2 [Nomascus leucogenys] |
| GI:557440904 | RefSeq | XP_003918745.1 | 168 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform X3 [Papio anubis] |
| GI:5453906 | RefSeq | XP_004057507.1 | 213 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform 1 [Gorilla gorilla gorilla] |
| GI:5453906 | RefSeq | XP_004057508.1 | 213 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform 2 [Gorilla gorilla gorilla] |
| GI:557440904 | RefSeq | XP_006896596.1 | 168 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform X2 [Elephantulus edwardii] |
| GI:557440904 | RefSeq | XP_007452812.1 | 168 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform X3 [Lipotes vexillifer] |
| GI:557440904 | RefSeq | XP_007987956.1 | 168 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase isoform X2 [Chlorocebus sabaeus] |