Gene/Proteome Database (LMPD)
LMPD ID
LMP002722
Gene ID
Species
Homo sapiens (Human)
Gene Name
ethanolamine kinase 1
Gene Symbol
Synonyms
EKI; EKI 1; EKI1; Nbla10396
Alternate Names
ethanolamine kinase 1; putative protein product of Nbla10396
Chromosome
12
Map Location
12p12.1
EC Number
2.7.1.82
Summary
This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| ethanolamine kinase 1 isoform A | |
|---|---|
| Refseq ID | NP_061108 |
| Protein GI | 10092615 |
| UniProt ID | Q9HBU6 |
| mRNA ID | NM_018638 |
| Length | 452 |
| RefSeq Status | REVIEWED |
| MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPAVLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADEDINKRFLSDIPSSQILQEEMTWMKEILSNLGSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLYPDRELQSQWLRAYLEAYKEFKGFGTEVTEKEVEILFIQVNQFALASHFFWGLWALIQAKYSTIEFDFLGYAIVRFNQYFKMKPEVTALKVPE | |
| ethanolamine kinase 1 isoform B | |
|---|---|
| Refseq ID | NP_001034570 |
| Protein GI | 87298843 |
| UniProt ID | Q9HBU6 |
| mRNA ID | NM_001039481 |
| Length | 258 |
| RefSeq Status | REVIEWED |
| MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPAVLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0004305 | IDA:UniProtKB | F | ethanolamine kinase activity |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0006646 | IDA:UniProtKB | P | phosphatidylethanolamine biosynthetic process |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121401 | Glycerophospholipid biosynthesis |
| REACT_120919 | Synthesis of PE |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR011009 | Protein kinase-like domain |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9HBU6-1; Sequence=Displayed; Name=2; IsoId=Q9HBU6-2; Sequence=VSP_047191; Note=No experimental confirmation available.; |
| Catalytic Activity | ATP + ethanolamine = ADP + O- phosphoethanolamine. |
| Function | Highly specific for ethanolamine phosphorylation. May be a rate-controlling step in phosphatidylethanolamine biosynthesis. |
| Pathway | Phospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from ethanolamine: step 1/3. |
| Similarity | Belongs to the choline/ethanolamine kinase family. |
| Subcellular Location | Cytoplasm. |
| Tissue Specificity | Expressed in kidney, liver, placenta, heart, leukocyte, ovary and testis. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002722 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 10092615 | RefSeq | NP_061108 | 452 | ethanolamine kinase 1 isoform A |
| 87298843 | RefSeq | NP_001034570 | 258 | ethanolamine kinase 1 isoform B |
Identical Sequences to LMP002722 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:10092615 | GenBank | AAH66907.1 | 452 | Ethanolamine kinase 1 [Homo sapiens] |
| GI:10092615 | GenBank | EAW96478.1 | 452 | ethanolamine kinase 1, isoform CRA_a [Homo sapiens] |
| GI:87298843 | GenBank | EAW96479.1 | 258 | ethanolamine kinase 1, isoform CRA_b [Homo sapiens] |
| GI:10092615 | GenBank | ADZ15599.1 | 452 | ethanolamine kinase 1, partial [synthetic construct] |
| GI:10092615 | GenBank | AIC51780.1 | 452 | ETNK1, partial [synthetic construct] |
| GI:10092615 | GenBank | AIC62770.1 | 452 | ETNK1, partial [synthetic construct] |
| GI:10092615 | SwissProt | Q9HBU6.1 | 452 | RecName: Full=Ethanolamine kinase 1; Short=EKI 1 [Homo sapiens] |
Related Sequences to LMP002722 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:87298843 | GenBank | EAW96478.1 | 452 | ethanolamine kinase 1, isoform CRA_a [Homo sapiens] |
| GI:87298843 | GenBank | AAH06111.2 | 249 | ETNK1 protein, partial [Homo sapiens] |
| GI:10092615 | GenBank | JAA09850.1 | 452 | ethanolamine kinase 1 [Pan troglodytes] |
| GI:10092615 | GenBank | JAA33689.1 | 452 | ethanolamine kinase 1 [Pan troglodytes] |
| GI:87298843 | GenBank | AIC62770.1 | 452 | ETNK1, partial [synthetic construct] |
| GI:10092615 | RefSeq | XP_002823070.1 | 452 | PREDICTED: ethanolamine kinase 1 isoform X1 [Pongo abelii] |
| GI:87298843 | RefSeq | XP_003778036.1 | 258 | PREDICTED: ethanolamine kinase 1 isoform X2 [Pongo abelii] |
| GI:10092615 | RefSeq | XP_003828930.1 | 452 | PREDICTED: ethanolamine kinase 1 isoform X1 [Pan paniscus] |
| GI:10092615 | RefSeq | XP_004052911.1 | 452 | PREDICTED: ethanolamine kinase 1 isoform 1 [Gorilla gorilla gorilla] |
| GI:87298843 | RefSeq | XP_004052912.1 | 258 | PREDICTED: ethanolamine kinase 1 isoform 2 [Gorilla gorilla gorilla] |
| GI:87298843 | RefSeq | XP_008952563.1 | 258 | PREDICTED: ethanolamine kinase 1 isoform X2 [Pan paniscus] |
| GI:10092615 | RefSeq | XP_009424009.1 | 452 | PREDICTED: ethanolamine kinase 1 [Pan troglodytes] |