Gene/Proteome Database (LMPD)
Proteins
arylacetamide deacetylase precursor | |
---|---|
Refseq ID | NP_075872 |
Protein GI | 13184050 |
UniProt ID | Q99PG0 |
mRNA ID | NM_023383 |
Length | 398 |
RefSeq Status | VALIDATED |
MGKTISLLISVVLVAYYLYIPLPDAIEEPWKVVWETAFVKIGTDLASFGELLGISHFMETIQLLMSFQEVPPTSDEHVTVMETAFDSVPVRIYIPKRKSMALRRGLFYIHGGGWCLGSAAHFSYDTLSRWTAHKLDAVVVSTDYGLAPKHHFPRQFEDVYRSLRWFLQEDVLEKYGVDPRRVGVSGDSAGGNLAAAVTQQLIQDPDVKIKLKVQALIYPALQALDTNVPSQQEGSHFPVLTRSLMVRFWSEYFTTDRGLEKAMLLNQHVPMESSHLLQFVNWSSLLPERYKKSPVYKNPTPGSSELAQKYPGFIDVKACPLLANDNILHHLPKTYIITCQYDVLRDDGLMYVKRLQNVGVHVTHHHVEDGFHGTFSFPGLKLSERMKNQYLSWLIKNL | |
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2753 peptide sequence: MGKTISLLISVVLVAYYLYIPLPDA |
Gene Information
Entrez Gene ID
Gene Name
arylacetamide deacetylase (esterase)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | IDA:UniProtKB | C | endoplasmic reticulum membrane |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0019213 | ISS:UniProtKB | F | deacetylase activity |
GO:0016298 | TAS:MGI | F | lipase activity |
GO:0017171 | IDA:UniProtKB | F | serine hydrolase activity |
GO:0004806 | IDA:UniProtKB | F | triglyceride lipase activity |
GO:0010898 | IDA:UniProtKB | P | positive regulation of triglyceride catabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
arylacetamide deacetylase (esterase)
Protein Entry
AAAD_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Triacylglycerol + H(2)O = diacylglycerol + a carboxylate. {ECO:0000269|PubMed:19654421}. |
Function | Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly (By similarity). Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity. {ECO:0000250, ECO:0000269|PubMed:19654421, ECO:0000269|PubMed:22207054}. |
Ptm | N-glycosylated. {ECO:0000269|PubMed:19654421}. |
Similarity | Belongs to the 'GDXG' lipolytic enzyme family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:19654421}; Single-pass type II membrane protein {ECO:0000269|PubMed:19654421}. Microsome membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. |
Tissue Specificity | Highest levels in liver with lower levels in jejunum and kidney. {ECO:0000269|PubMed:19654421, ECO:0000269|PubMed:22207054}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002725 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
13184050 | RefSeq | NP_075872 | 398 | arylacetamide deacetylase precursor |
Identical Sequences to LMP002725 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13184050 | GenBank | AAG60035.1 | 398 | arylacetamide deacetylase [Mus musculus] |
GI:13184050 | SwissProt | Q99PG0.3 | 398 | RecName: Full=Arylacetamide deacetylase [Mus musculus] |
Related Sequences to LMP002725 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13184050 | GenBank | AAD56394.1 | 398 | arylacetamide deacetylase [Rattus norvegicus] |
GI:13184050 | GenBank | AAH19999.1 | 398 | Arylacetamide deacetylase (esterase) [Mus musculus] |
GI:13184050 | GenBank | AAH54823.1 | 398 | Arylacetamide deacetylase (esterase) [Mus musculus] |
GI:13184050 | GenBank | AAH88143.1 | 398 | Arylacetamide deacetylase (esterase) [Rattus norvegicus] |
GI:13184050 | GenBank | EDL35371.1 | 404 | arylacetamide deacetylase (esterase), isoform CRA_b, partial [Mus musculus] |
GI:13184050 | GenBank | EDM14838.1 | 398 | arylacetamide deacetylase (esterase), isoform CRA_a [Rattus norvegicus] |