Gene/Proteome Database (LMPD)

LMPD ID
LMP002750
Gene ID
8702
Species
Homo sapiens (Human)
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Gene Symbol
B4GALT4
Synonyms
B4Gal-T4; beta4Gal-T4
Chromosome
3
Map Location
3q13.3
Summary
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene appears to mainly play a role in glycolipid biosynthesis. Two alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for B4GALT4

Proteins

beta-1,4-galactosyltransferase 4
Refseq ID NP_997708
Protein GI 47078258
UniProt ID O60513
mRNA ID NM_212543
Length 344
RefSeq Status REVIEWED
MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
beta-1,4-galactosyltransferase 4
Refseq ID NP_003769
Protein GI 9994175
UniProt ID O60513
mRNA ID NM_003778
Length 344
RefSeq Status REVIEWED
Protein sequence is identical to GI:47078258 (mRNA isoform)

Gene Information

Entrez Gene ID
8702
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Gene Symbol
B4GALT4
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016757 IEA:UniProtKB-KW F transferase activity, transferring glycosyl groups
GO:0005975 IEA:InterPro P carbohydrate metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00533 Glycosaminoglycan biosynthesis - keratan sulfate

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_121120 Keratan sulfate biosynthesis
REACT_25085 N-Glycan antennae elongation

Domain Information

InterPro Annotations

Accession Description
IPR003859 Beta-1,4-galactosyltransferase
IPR027791 Galactosyltransferase, C-terminal
IPR027995 Galactosyltransferase, N-terminal
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Protein Entry
B4GT4_HUMAN
UniProt ID
O60513
Species
Human

Identical and Related Proteins

Unique RefSeq proteins for LMP002750 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
47078258 RefSeq NP_997708 344 beta-1,4-galactosyltransferase 4

Identical Sequences to LMP002750 proteins

Reference Database Accession Length Protein Name
GI:47078258 GenBank AEU55173.1 344 Sequence 178 from patent US 8063186
GI:47078258 RefSeq XP_005247912.1 344 PREDICTED: beta-1,4-galactosyltransferase 4 isoform X1 [Homo sapiens]
GI:47078258 RefSeq XP_006713861.1 344 PREDICTED: beta-1,4-galactosyltransferase 4 isoform X4 [Homo sapiens]
GI:47078258 RefSeq XP_006713862.1 344 PREDICTED: beta-1,4-galactosyltransferase 4 isoform X5 [Homo sapiens]
GI:47078258 RefSeq XP_006713863.1 344 PREDICTED: beta-1,4-galactosyltransferase 4 isoform X6 [Homo sapiens]
GI:47078258 RefSeq XP_006713864.1 344 PREDICTED: beta-1,4-galactosyltransferase 4 isoform X7 [Homo sapiens]

Related Sequences to LMP002750 proteins

Reference Database Accession Length Protein Name
GI:47078258 EMBL CAH18352.1 344 hypothetical protein [Homo sapiens]
GI:47078258 GenBank AAH04523.1 344 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 [Homo sapiens]
GI:47078258 GenBank AAH62618.1 344 B4GALT4 protein [Homo sapiens]
GI:47078258 GenBank ACM82140.1 356 Sequence 7638 from patent US 6812339
GI:47078258 GenBank AIC55458.1 344 B4GALT4, partial [synthetic construct]
GI:47078258 GenBank AIC55459.1 344 B4GALT4, partial [synthetic construct]