Gene/Proteome Database (LMPD)

LMPD ID
LMP002753
Gene ID
55979
Species
Mus musculus (Mouse)
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha)
Gene Symbol
Agpat1
Synonyms
1-AGP; 1-AGPAT; AW047140
Alternate Names
1-acyl-sn-glycerol-3-phosphate acyltransferase alpha; 1-AGPAT 1; Lpaat-alpha; 1-AGP acyltransferase 1; lysophosphatidic acid acyltransferase alpha
Chromosome
17
Map Location
17 B1|17 18.18 cM
EC Number
2.3.1.51

Proteins

1-acyl-sn-glycerol-3-phosphate acyltransferase alpha precursor
Refseq ID NP_001156851
Protein GI 254281341
UniProt ID O35083
mRNA ID NM_001163379
Length 285
RefSeq Status VALIDATED
MELWPGAWTALLLLLLLLLSTLWFCSSSAKYFFKMAFYNGWILFLAILAIPVCAVRGRNVENMKILRLLLLHVKYLYGIRVEVRGAHHFPPTQPYVVVSNHQSSLDLLGMMEVLPDRCVPIAKRELLWAGSAGLACWLAGIIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIIPIVMSSYQDFYSKKERRFTSPGRCQVRVLPPVSTEGLTPDDVPALADSVRHSMLTIFREISTDGLGGGDCLKKPGGAGEARL
1-acyl-sn-glycerol-3-phosphate acyltransferase alpha precursor
Refseq ID NP_061350
Protein GI 254281343
UniProt ID O35083
mRNA ID NM_018862
Length 285
RefSeq Status VALIDATED
Protein sequence is identical to GI:254281341 (mRNA isoform)
sig_peptide: 1..28 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (O35083.1) calculated_mol_wt: 3179 peptide sequence: MELWPGAWTALLLLLLLLLSTLWFCSSS mat_peptide: 29..285 product: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (O35083.1) calculated_mol_wt: 28577 peptide sequence: AKYFFKMAFYNGWILFLAILAIPVCAVRGRNVENMKILRLLLLHVKYLYGIRVEVRGAHHFPPTQPYVVVSNHQSSLDLLGMMEVLPDRCVPIAKRELLWAGSAGLACWLAGIIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIIPIVMSSYQDFYSKKERRFTSPGRCQVRVLPPVSTEGLTPDDVPALADSVRHSMLTIFREISTDGLGGGDCLKKPGGAGEARL sig_peptide: 1..28 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (O35083.1) calculated_mol_wt: 3179 peptide sequence: MELWPGAWTALLLLLLLLLSTLWFCSSS mat_peptide: 29..285 product: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (O35083.1) calculated_mol_wt: 28577 peptide sequence: AKYFFKMAFYNGWILFLAILAIPVCAVRGRNVENMKILRLLLLHVKYLYGIRVEVRGAHHFPPTQPYVVVSNHQSSLDLLGMMEVLPDRCVPIAKRELLWAGSAGLACWLAGIIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIIPIVMSSYQDFYSKKERRFTSPGRCQVRVLPPVSTEGLTPDDVPALADSVRHSMLTIFREISTDGLGGGDCLKKPGGAGEARL

Gene Information

Entrez Gene ID
55979
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha)
Gene Symbol
Agpat1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003841 IDA:MGI F 1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0016024 IEA:UniProtKB-UniPathway P CDP-diacylglycerol biosynthetic process
GO:0006654 IDA:MGI P phosphatidic acid biosynthetic process
GO:0001819 IEA:Ensembl P positive regulation of cytokine production

KEGG Pathway Links

KEGG Pathway ID Description
mmu04975 Fat digestion and absorption
mmu00561 Glycerolipid metabolism
mmu00564 Glycerophospholipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR004552 1-acyl-sn-glycerol-3-phosphate acyltransferase
IPR002123 Phospholipid/glycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha)
Protein Entry
PLCA_MOUSE
UniProt ID
O35083
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}.
Function Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
Pathway Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3.
Similarity Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Tissue Specificity Widely expressed. {ECO:0000269|PubMed:15367102}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002753 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
254281341 RefSeq NP_001156851 285 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha precursor

Identical Sequences to LMP002753 proteins

Reference Database Accession Length Protein Name
GI:254281341 RefSeq XP_006536736.1 285 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X1 [Mus musculus]
GI:254281341 RefSeq XP_006536737.1 285 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X2 [Mus musculus]
GI:254281341 RefSeq XP_006537467.1 285 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X1 [Mus musculus]
GI:254281341 RefSeq XP_006537468.1 285 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X2 [Mus musculus]
GI:254281341 RefSeq XP_006525487.1 285 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X1 [Mus musculus]
GI:254281341 RefSeq XP_006525488.1 285 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X2 [Mus musculus]

Related Sequences to LMP002753 proteins

Reference Database Accession Length Protein Name
GI:254281341 DBBJ BAA22599.1 285 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mus musculus]
GI:254281341 DBBJ BAC39641.1 326 unnamed protein product [Mus musculus]
GI:254281341 GenBank AAH09651.1 285 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Mus musculus]
GI:254281341 GenBank ACS08437.1 285 Sequence 58 from patent US 7537920
GI:254281341 RefSeq NP_997623.1 284 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha [Rattus norvegicus]
GI:254281341 SwissProt O35083.1 285 RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase alpha; AltName: Full=1-acylglycerol-3-phosphate O-acyltransferase 1; Short=1-AGP acyltransferase 1; Short=1-AGPAT 1; AltName: Full=Lysophosphatidic acid acyltransferase alpha; Short=LPAAT-alpha; Flags: Precursor [Mus musculus]