Gene/Proteome Database (LMPD)

LMPD ID
LMP002797
Gene ID
54486
Species
Mus musculus (Mouse)
Gene Name
hematopoietic prostaglandin D synthase
Gene Symbol
Hpgds
Synonyms
H-PGDS; Ptgds2
Alternate Names
hematopoietic prostaglandin D synthase; GST class-sigma; glutathione S-transferase; prostaglandin-H2 D-isomerase; glutathione-dependent PGD synthase; glutathione-dependent PGD synthetase; prostaglandin D2 synthase 2, hematopoietic; glutathione-requiring prostaglandin D synthase
Chromosome
6
Map Location
6|6 D-E
EC Number
5.3.99.2

Proteins

hematopoietic prostaglandin D synthase
Refseq ID NP_062328
Protein GI 254281300
UniProt ID Q9JHF7
mRNA ID NM_019455
Length 199
RefSeq Status VALIDATED
MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFPWAEKDQDLKERMFNELLTHQAPRLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKVQAIPAISAWILKRPQTKL

Gene Information

Entrez Gene ID
54486
Gene Name
hematopoietic prostaglandin D synthase
Gene Symbol
Hpgds
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0005509 ISS:UniProtKB F calcium ion binding
GO:0004364 ISO:MGI F glutathione transferase activity
GO:0000287 ISS:UniProtKB F magnesium ion binding
GO:0004667 IDA:MGI F prostaglandin-D synthase activity
GO:0001516 IEA:UniProtKB-KW P prostaglandin biosynthetic process
GO:0006693 IDA:MGI P prostaglandin metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00590 Arachidonic acid metabolism
mmu01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY3DJ-35583 biosynthesis of prostaglandins

REACTOME Pathway Links

REACTOME Pathway ID Description
5893002 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Domain Information

InterPro Annotations

Accession Description
IPR004046 Glutathione S-transferase, C-terminal
IPR010987 Glutathione S-transferase, C-terminal-like
IPR004045 Glutathione S-transferase, N-terminal
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
hematopoietic prostaglandin D synthase
Protein Entry
HPGDS_MOUSE
UniProt ID
Q9JHF7
Species
Mouse

Comments

Comment Type Description
Catalytic Activity (5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy- 11-oxoprosta-5,13-dienoate. {ECO:0000269|PubMed:10824118}.
Catalytic Activity RX + glutathione = HX + R-S-glutathione. {ECO:0000269|PubMed:10824118}.
Cofactor Name=glutathione; Xref=ChEBI:CHEBI:57925; Evidence={ECO:0000269|PubMed:10824118}; Note=Glutathione is required for the prostaglandin D synthase activity. {ECO:0000269|PubMed:10824118};
Function Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity. {ECO:0000269|PubMed:10824118, ECO:0000269|PubMed:16547010}.
Similarity Belongs to the GST superfamily. Sigma family. {ECO:0000305}.
Similarity Contains 1 GST C-terminal domain. {ECO:0000305}.
Similarity Contains 1 GST N-terminal domain. {ECO:0000305}.
Subcellular Location Cytoplasm.
Subunit Homodimer. {ECO:0000250}.
Tissue Specificity Expressed in skin and oviduct. {ECO:0000269|PubMed:10824118}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002797 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
254281300 RefSeq NP_062328 199 hematopoietic prostaglandin D synthase

Identical Sequences to LMP002797 proteins

Reference Database Accession Length Protein Name
GI:254281300 DBBJ BAA97557.1 199 hematopoietic prostaglandin D synthase [Mus musculus]
GI:254281300 DBBJ BAB32037.1 199 unnamed protein product [Mus musculus]
GI:254281300 GenBank AAI16736.1 199 Prostaglandin D2 synthase 2, hematopoietic [Mus musculus]
GI:254281300 GenBank AAI16738.1 199 Prostaglandin D2 synthase 2, hematopoietic [Mus musculus]
GI:254281300 GenBank EDK98774.1 199 prostaglandin D2 synthase 2, hematopoietic [Mus musculus]
GI:254281300 SwissProt Q9JHF7.3 199 RecName: Full=Hematopoietic prostaglandin D synthase; Short=H-PGDS; AltName: Full=GST class-sigma; AltName: Full=Glutathione S-transferase; AltName: Full=Glutathione-dependent PGD synthase; AltName: Full=Glutathione-requiring prostaglandin D synthase; AltName: Full=Prostaglandin-H2 D-isomerase [Mus musculus]

Related Sequences to LMP002797 proteins

Reference Database Accession Length Protein Name
GI:254281300 DBBJ BAA22898.1 199 hematopoietic prostaglandin D synthase [Rattus norvegicus]
GI:254281300 DBBJ BAC30336.1 199 unnamed protein product [Mus musculus]
GI:254281300 GenBank EDL91600.1 199 prostaglandin D2 synthase 2, isoform CRA_a [Rattus norvegicus]
GI:254281300 RefSeq NP_113832.1 199 hematopoietic prostaglandin D synthase [Rattus norvegicus]
GI:254281300 RefSeq XP_006506461.1 200 PREDICTED: hematopoietic prostaglandin D synthase isoform X1 [Mus musculus]
GI:254281300 SwissProt O35543.3 199 RecName: Full=Hematopoietic prostaglandin D synthase; Short=H-PGDS; AltName: Full=GST class-sigma; AltName: Full=Glutathione S-transferase; AltName: Full=Glutathione-dependent PGD synthase; AltName: Full=Glutathione-requiring prostaglandin D synthase; AltName: Full=Prostaglandin-H2 D-isomerase [Rattus norvegicus]