Gene/Proteome Database (LMPD)
LMPD ID
LMP002797
Gene ID
Species
Mus musculus (Mouse)
Gene Name
hematopoietic prostaglandin D synthase
Gene Symbol
Synonyms
H-PGDS; Ptgds2
Alternate Names
hematopoietic prostaglandin D synthase; GST class-sigma; glutathione S-transferase; prostaglandin-H2 D-isomerase; glutathione-dependent PGD synthase; glutathione-dependent PGD synthetase; prostaglandin D2 synthase 2, hematopoietic; glutathione-requiring prostaglandin D synthase
Chromosome
6
Map Location
6|6 D-E
EC Number
5.3.99.2
Proteins
| hematopoietic prostaglandin D synthase | |
|---|---|
| Refseq ID | NP_062328 |
| Protein GI | 254281300 |
| UniProt ID | Q9JHF7 |
| mRNA ID | NM_019455 |
| Length | 199 |
| RefSeq Status | VALIDATED |
| MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFPWAEKDQDLKERMFNELLTHQAPRLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKVQAIPAISAWILKRPQTKL | |
Gene Information
Entrez Gene ID
Gene Name
hematopoietic prostaglandin D synthase
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0005509 | ISS:UniProtKB | F | calcium ion binding |
| GO:0004364 | ISO:MGI | F | glutathione transferase activity |
| GO:0000287 | ISS:UniProtKB | F | magnesium ion binding |
| GO:0004667 | IDA:MGI | F | prostaglandin-D synthase activity |
| GO:0001516 | IEA:UniProtKB-KW | P | prostaglandin biosynthetic process |
| GO:0006693 | IDA:MGI | P | prostaglandin metabolic process |
KEGG Pathway Links
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY3DJ-35583 | biosynthesis of prostaglandins |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5893002 | Synthesis of Prostaglandins (PG) and Thromboxanes (TX) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
hematopoietic prostaglandin D synthase
Protein Entry
HPGDS_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | (5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy- 11-oxoprosta-5,13-dienoate. {ECO:0000269|PubMed:10824118}. |
| Catalytic Activity | RX + glutathione = HX + R-S-glutathione. {ECO:0000269|PubMed:10824118}. |
| Cofactor | Name=glutathione; Xref=ChEBI:CHEBI:57925; Evidence={ECO:0000269|PubMed:10824118}; Note=Glutathione is required for the prostaglandin D synthase activity. {ECO:0000269|PubMed:10824118}; |
| Function | Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity. {ECO:0000269|PubMed:10824118, ECO:0000269|PubMed:16547010}. |
| Similarity | Belongs to the GST superfamily. Sigma family. {ECO:0000305}. |
| Similarity | Contains 1 GST C-terminal domain. {ECO:0000305}. |
| Similarity | Contains 1 GST N-terminal domain. {ECO:0000305}. |
| Subcellular Location | Cytoplasm. |
| Subunit | Homodimer. {ECO:0000250}. |
| Tissue Specificity | Expressed in skin and oviduct. {ECO:0000269|PubMed:10824118}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002797 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 254281300 | RefSeq | NP_062328 | 199 | hematopoietic prostaglandin D synthase |
Identical Sequences to LMP002797 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254281300 | DBBJ | BAA97557.1 | 199 | hematopoietic prostaglandin D synthase [Mus musculus] |
| GI:254281300 | DBBJ | BAB32037.1 | 199 | unnamed protein product [Mus musculus] |
| GI:254281300 | GenBank | AAI16736.1 | 199 | Prostaglandin D2 synthase 2, hematopoietic [Mus musculus] |
| GI:254281300 | GenBank | AAI16738.1 | 199 | Prostaglandin D2 synthase 2, hematopoietic [Mus musculus] |
| GI:254281300 | GenBank | EDK98774.1 | 199 | prostaglandin D2 synthase 2, hematopoietic [Mus musculus] |
| GI:254281300 | SwissProt | Q9JHF7.3 | 199 | RecName: Full=Hematopoietic prostaglandin D synthase; Short=H-PGDS; AltName: Full=GST class-sigma; AltName: Full=Glutathione S-transferase; AltName: Full=Glutathione-dependent PGD synthase; AltName: Full=Glutathione-requiring prostaglandin D synthase; AltName: Full=Prostaglandin-H2 D-isomerase [Mus musculus] |
Related Sequences to LMP002797 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254281300 | DBBJ | BAA22898.1 | 199 | hematopoietic prostaglandin D synthase [Rattus norvegicus] |
| GI:254281300 | DBBJ | BAC30336.1 | 199 | unnamed protein product [Mus musculus] |
| GI:254281300 | GenBank | EDL91600.1 | 199 | prostaglandin D2 synthase 2, isoform CRA_a [Rattus norvegicus] |
| GI:254281300 | RefSeq | NP_113832.1 | 199 | hematopoietic prostaglandin D synthase [Rattus norvegicus] |
| GI:254281300 | RefSeq | XP_006506461.1 | 200 | PREDICTED: hematopoietic prostaglandin D synthase isoform X1 [Mus musculus] |
| GI:254281300 | SwissProt | O35543.3 | 199 | RecName: Full=Hematopoietic prostaglandin D synthase; Short=H-PGDS; AltName: Full=GST class-sigma; AltName: Full=Glutathione S-transferase; AltName: Full=Glutathione-dependent PGD synthase; AltName: Full=Glutathione-requiring prostaglandin D synthase; AltName: Full=Prostaglandin-H2 D-isomerase [Rattus norvegicus] |