Gene/Proteome Database (LMPD)

LMPD ID
LMP002801
Gene ID
Species
Homo sapiens (Human)
Gene Name
cardiolipin synthase 1
Gene Symbol
Synonyms
C20orf155; CLS; CLS1; GCD10; dJ967N21.6
Alternate Names
cardiolipin synthase
Chromosome
20
Map Location
20p13-p12.3
EC Number
2.7.8.-

Proteins

cardiolipin synthase isoform 1
Refseq ID NP_061968
Protein GI 10092647
UniProt ID Q9UJA2
mRNA ID NM_019095
Length 301
RefSeq Status VALIDATED
MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRLPGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISILYVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIKD
cardiolipin synthase isoform 2
Refseq ID NP_001120930
Protein GI 188536108
UniProt ID Q9UJA2
mRNA ID NM_001127458
Length 202
RefSeq Status VALIDATED
MPQYENPWTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISILYVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIKD

Gene Information

Entrez Gene ID
Gene Name
cardiolipin synthase 1
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005743 TAS:Reactome C mitochondrial inner membrane
GO:0016780 IEA:InterPro F phosphotransferase activity, for other substituted phosphate groups
GO:0032049 TAS:Reactome P cardiolipin biosynthetic process
GO:0046474 TAS:Reactome P glycerophospholipid biosynthetic process
GO:0036148 TAS:Reactome P phosphatidylglycerol acyl-chain remodeling
GO:0006644 TAS:Reactome P phospholipid metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00564 Glycerophospholipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_121324 Acyl chain remodelling of PG
REACT_121401 Glycerophospholipid biosynthesis
REACT_120920 Synthesis of CL

Domain Information

InterPro Annotations

Accession Description
IPR000462 CDP-alcohol phosphatidyltransferase

UniProt Annotations

Entry Information

Gene Name
cardiolipin synthase 1
Protein Entry
CRLS1_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9UJA2-1; Sequence=Displayed; Name=2; IsoId=Q9UJA2-2; Sequence=VSP_041398, VSP_041399; Note=No experimental confirmation available.;
Catalytic Activity 2 Phosphatidylglycerol = diphosphatidylglycerol + glycerol.
Function Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Similarity Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
Subcellular Location Mitochondrion inner membrane ; Multi-pass membrane protein .
Tissue Specificity Highly expressed in tissues such as heart, skeletal muscle and liver.

Identical and Related Proteins

Unique RefSeq proteins for LMP002801 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
10092647 RefSeq NP_061968 301 cardiolipin synthase isoform 1
188536108 RefSeq NP_001120930 202 cardiolipin synthase isoform 2

Identical Sequences to LMP002801 proteins

Reference Database Accession Length Protein Name
GI:10092647 GenBank JAA03286.1 301 cardiolipin synthase 1 [Pan troglodytes]
GI:10092647 GenBank JAA15710.1 301 cardiolipin synthase 1 [Pan troglodytes]
GI:10092647 GenBank JAA27873.1 301 cardiolipin synthase 1 [Pan troglodytes]
GI:10092647 GenBank JAA35495.1 301 cardiolipin synthase 1 [Pan troglodytes]
GI:10092647 GenBank AHD75056.1 301 Sequence 16335 from patent US 8586006
GI:188536108 RefSeq XP_003821404.1 202 PREDICTED: cardiolipin synthase isoform X1 [Pan paniscus]
GI:10092647 RefSeq XP_004061837.1 301 PREDICTED: cardiolipin synthase isoform 1 [Gorilla gorilla gorilla]
GI:188536108 RefSeq XP_004061838.1 202 PREDICTED: cardiolipin synthase isoform 2 [Gorilla gorilla gorilla]

Related Sequences to LMP002801 proteins

Reference Database Accession Length Protein Name
GI:188536108 DBBJ BAE00852.1 202 unnamed protein product [Macaca fascicularis]
GI:10092647 GenBank AFE78854.1 301 cardiolipin synthase isoform 1 [Macaca mulatta]
GI:10092647 GenBank AFI34374.1 301 cardiolipin synthase isoform 1 [Macaca mulatta]
GI:10092647 RefSeq XP_002829991.1 301 PREDICTED: cardiolipin synthase [Pongo abelii]
GI:10092647 RefSeq XP_003905102.1 301 PREDICTED: cardiolipin synthase isoform X1 [Papio anubis]
GI:188536108 RefSeq XP_003252364.2 202 PREDICTED: cardiolipin synthase [Nomascus leucogenys]
GI:188536108 RefSeq XP_004634341.1 203 PREDICTED: cardiolipin synthase [Octodon degus]
GI:188536108 RefSeq XP_005380906.1 203 PREDICTED: cardiolipin synthase isoform X6 [Chinchilla lanigera]
GI:10092647 RefSeq XP_005568448.1 301 PREDICTED: cardiolipin synthase [Macaca fascicularis]
GI:10092647 RefSeq XP_008016864.1 301 PREDICTED: cardiolipin synthase isoform X1 [Chlorocebus sabaeus]
GI:188536108 RefSeq XP_008016874.1 202 PREDICTED: cardiolipin synthase isoform X2 [Chlorocebus sabaeus]
GI:188536108 RefSeq XP_009214790.1 202 PREDICTED: cardiolipin synthase isoform X2 [Papio anubis]