Gene/Proteome Database (LMPD)
Proteins
| cardiolipin synthase isoform 1 | |
|---|---|
| Refseq ID | NP_061968 |
| Protein GI | 10092647 |
| UniProt ID | Q9UJA2 |
| mRNA ID | NM_019095 |
| Length | 301 |
| RefSeq Status | VALIDATED |
| MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRLPGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISILYVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIKD | |
| cardiolipin synthase isoform 2 | |
|---|---|
| Refseq ID | NP_001120930 |
| Protein GI | 188536108 |
| UniProt ID | Q9UJA2 |
| mRNA ID | NM_001127458 |
| Length | 202 |
| RefSeq Status | VALIDATED |
| MPQYENPWTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISILYVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIKD | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005743 | TAS:Reactome | C | mitochondrial inner membrane |
| GO:0016780 | IEA:InterPro | F | phosphotransferase activity, for other substituted phosphate groups |
| GO:0032049 | TAS:Reactome | P | cardiolipin biosynthetic process |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0036148 | TAS:Reactome | P | phosphatidylglycerol acyl-chain remodeling |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121324 | Acyl chain remodelling of PG |
| REACT_121401 | Glycerophospholipid biosynthesis |
| REACT_120920 | Synthesis of CL |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000462 | CDP-alcohol phosphatidyltransferase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9UJA2-1; Sequence=Displayed; Name=2; IsoId=Q9UJA2-2; Sequence=VSP_041398, VSP_041399; Note=No experimental confirmation available.; |
| Catalytic Activity | 2 Phosphatidylglycerol = diphosphatidylglycerol + glycerol. |
| Function | Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol. |
| Similarity | Belongs to the CDP-alcohol phosphatidyltransferase class-I family. |
| Subcellular Location | Mitochondrion inner membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Highly expressed in tissues such as heart, skeletal muscle and liver. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002801 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 10092647 | RefSeq | NP_061968 | 301 | cardiolipin synthase isoform 1 |
| 188536108 | RefSeq | NP_001120930 | 202 | cardiolipin synthase isoform 2 |
Identical Sequences to LMP002801 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:10092647 | GenBank | JAA03286.1 | 301 | cardiolipin synthase 1 [Pan troglodytes] |
| GI:10092647 | GenBank | JAA15710.1 | 301 | cardiolipin synthase 1 [Pan troglodytes] |
| GI:10092647 | GenBank | JAA27873.1 | 301 | cardiolipin synthase 1 [Pan troglodytes] |
| GI:10092647 | GenBank | JAA35495.1 | 301 | cardiolipin synthase 1 [Pan troglodytes] |
| GI:10092647 | GenBank | AHD75056.1 | 301 | Sequence 16335 from patent US 8586006 |
| GI:188536108 | RefSeq | XP_003821404.1 | 202 | PREDICTED: cardiolipin synthase isoform X1 [Pan paniscus] |
| GI:10092647 | RefSeq | XP_004061837.1 | 301 | PREDICTED: cardiolipin synthase isoform 1 [Gorilla gorilla gorilla] |
| GI:188536108 | RefSeq | XP_004061838.1 | 202 | PREDICTED: cardiolipin synthase isoform 2 [Gorilla gorilla gorilla] |
Related Sequences to LMP002801 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:188536108 | DBBJ | BAE00852.1 | 202 | unnamed protein product [Macaca fascicularis] |
| GI:10092647 | GenBank | AFE78854.1 | 301 | cardiolipin synthase isoform 1 [Macaca mulatta] |
| GI:10092647 | GenBank | AFI34374.1 | 301 | cardiolipin synthase isoform 1 [Macaca mulatta] |
| GI:10092647 | RefSeq | XP_002829991.1 | 301 | PREDICTED: cardiolipin synthase [Pongo abelii] |
| GI:10092647 | RefSeq | XP_003905102.1 | 301 | PREDICTED: cardiolipin synthase isoform X1 [Papio anubis] |
| GI:188536108 | RefSeq | XP_003252364.2 | 202 | PREDICTED: cardiolipin synthase [Nomascus leucogenys] |
| GI:188536108 | RefSeq | XP_004634341.1 | 203 | PREDICTED: cardiolipin synthase [Octodon degus] |
| GI:188536108 | RefSeq | XP_005380906.1 | 203 | PREDICTED: cardiolipin synthase isoform X6 [Chinchilla lanigera] |
| GI:10092647 | RefSeq | XP_005568448.1 | 301 | PREDICTED: cardiolipin synthase [Macaca fascicularis] |
| GI:10092647 | RefSeq | XP_008016864.1 | 301 | PREDICTED: cardiolipin synthase isoform X1 [Chlorocebus sabaeus] |
| GI:188536108 | RefSeq | XP_008016874.1 | 202 | PREDICTED: cardiolipin synthase isoform X2 [Chlorocebus sabaeus] |
| GI:188536108 | RefSeq | XP_009214790.1 | 202 | PREDICTED: cardiolipin synthase isoform X2 [Papio anubis] |