Gene/Proteome Database (LMPD)
LMPD ID
LMP002816
Gene ID
Species
Homo sapiens (Human)
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1
Gene Symbol
Synonyms
B4GAL-T1; CDG2D; GGTB2; GT1; GTB; beta4Gal-T1
Alternate Names
beta-1,4-galactosyltransferase 1; lactose synthase; beta-1,4-GalTase 1; glycoprotein-4-beta-galactosyltransferase 2; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1
Chromosome
9
Map Location
9p13
EC Number
2.4.1.-
Summary
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. This gene is unique among the beta4GalT genes because it encodes an enzyme that participates both in glycoconjugate and lactose biosynthesis. For the first activity, the enzyme adds galactose to N-acetylglucosamine residues that are either monosaccharides or the nonreducing ends of glycoprotein carbohydrate chains. The second activity is restricted to lactating mammary tissues where the enzyme forms a heterodimer with alpha-lactalbumin to catalyze UDP-galactose + D-glucose <=> UDP + lactose. The two enzymatic forms result from alternate transcription initiation sites and post-translational processing. Two transcripts, which differ only at the 5' end, with approximate lengths of 4.1 kb and 3.9 kb encode the same protein. The longer transcript encodes the type II membrane-bound, trans-Golgi resident protein involved in glycoconjugate biosynthesis. The shorter transcript encodes a protein which is cleaved to form the soluble lactose synthase. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| beta-1,4-galactosyltransferase 1 | |
|---|---|
| Refseq ID | NP_001488 |
| Protein GI | 13929462 |
| UniProt ID | P15291 |
| mRNA ID | NM_001497 |
| Length | 398 |
| RefSeq Status | |
| MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS | |
| mat_peptide: 78..398 product: beta-1,4-galactosyltransferase 1, soluble form calculated_mol_wt: 36047 peptide sequence: RTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS | |
Gene Information
Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:UniProtKB | C | Golgi apparatus |
| GO:0000139 | TAS:Reactome | C | Golgi membrane |
| GO:0000138 | IDA:UniProtKB | C | Golgi trans cisterna |
| GO:0016323 | IDA:UniProtKB | C | basolateral plasma membrane |
| GO:0031526 | IDA:UniProtKB | C | brush border membrane |
| GO:0030057 | IDA:UniProtKB | C | desmosome |
| GO:0009897 | IDA:UniProtKB | C | external side of plasma membrane |
| GO:0005615 | IDA:UniProt | C | extracellular space |
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0030112 | IDA:UniProtKB | C | glycocalyx |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0005886 | TAS:Reactome | C | plasma membrane |
| GO:0003945 | IDA:UniProtKB | F | N-acetyllactosamine synthase activity |
| GO:0035250 | IDA:UniProtKB | F | UDP-galactosyltransferase activity |
| GO:0043014 | IDA:UniProtKB | F | alpha-tubulin binding |
| GO:0003831 | IDA:UniProtKB | F | beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity |
| GO:0048487 | IPI:UniProtKB | F | beta-tubulin binding |
| GO:0008378 | NAS:UniProtKB | F | galactosyltransferase activity |
| GO:0004461 | IDA:UniProtKB | F | lactose synthase activity |
| GO:0030145 | IDA:UniProtKB | F | manganese ion binding |
| GO:0042803 | IDA:UniProtKB | F | protein homodimerization activity |
| GO:0007219 | TAS:Reactome | P | Notch signaling pathway |
| GO:0002526 | IEA:Ensembl | P | acute inflammatory response |
| GO:0060055 | IEA:Ensembl | P | angiogenesis involved in wound healing |
| GO:0007339 | TAS:Reactome | P | binding of sperm to zona pellucida |
| GO:0048754 | IEA:Ensembl | P | branching morphogenesis of an epithelial tube |
| GO:0005975 | TAS:Reactome | P | carbohydrate metabolic process |
| GO:0007155 | IEA:Ensembl | P | cell adhesion |
| GO:0044267 | TAS:Reactome | P | cellular protein metabolic process |
| GO:0045136 | IEA:Ensembl | P | development of secondary sexual characteristics |
| GO:0002064 | IEA:Ensembl | P | epithelial cell development |
| GO:0030198 | IEA:Ensembl | P | extracellular matrix organization |
| GO:0006012 | IEA:Ensembl | P | galactose metabolic process |
| GO:0030203 | TAS:Reactome | P | glycosaminoglycan metabolic process |
| GO:0018146 | TAS:Reactome | P | keratan sulfate biosynthetic process |
| GO:0042339 | TAS:Reactome | P | keratan sulfate metabolic process |
| GO:0005989 | IEA:Ensembl | P | lactose biosynthetic process |
| GO:0050900 | IEA:Ensembl | P | leukocyte migration |
| GO:0030879 | IEA:Ensembl | P | mammary gland development |
| GO:0032504 | TAS:Reactome | P | multicellular organism reproduction |
| GO:0008285 | IEA:Ensembl | P | negative regulation of cell proliferation |
| GO:0009312 | IDA:UniProtKB | P | oligosaccharide biosynthetic process |
| GO:0007341 | IEA:Ensembl | P | penetration of zona pellucida |
| GO:0060058 | IEA:Ensembl | P | positive regulation of apoptotic process involved in mammary gland involution |
| GO:0060054 | IEA:Ensembl | P | positive regulation of epithelial cell proliferation involved in wound healing |
| GO:0043687 | TAS:Reactome | P | post-translational protein modification |
| GO:0006487 | IDA:UniProtKB | P | protein N-linked glycosylation |
| GO:0018279 | TAS:Reactome | P | protein N-linked glycosylation via asparagine |
| GO:0060046 | IEA:Ensembl | P | regulation of acrosome reaction |
| GO:0051270 | IEA:Ensembl | P | regulation of cellular component movement |
| GO:0007338 | TAS:Reactome | P | single fertilization |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00533 | Glycosaminoglycan biosynthesis - keratan sulfate |
| hsa00510 | N-Glycan biosynthesis |
| hsa00514 | Other types of O-glycan biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_163933 | Interaction With The Zona Pellucida |
Domain Information
UniProt Annotations
Entry Information
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1
Protein Entry
B4GT1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative initiation; Named isoforms=2; Name=Long; Synonyms=Cell surface; IsoId=P15291-1; Sequence=Displayed; Name=Short; Synonyms=Golgi complex; IsoId=P15291-2; Sequence=VSP_018802; |
| Catalytic Activity | UDP-alpha-D-galactose + D-glucose = UDP + lactose. |
| Catalytic Activity | UDP-alpha-D-galactose + N-acetyl-D-glucosamine = UDP + N-acetyllactosamine. |
| Catalytic Activity | UDP-alpha-D-galactose + N-acetyl-beta-D- glucosaminylglycopeptide = UDP + beta-D-galactosyl-(1->4)-N- acetyl-beta-D-glucosaminylglycopeptide. |
| Cofactor | Name=Mn(2+); Xref=ChEBI |
| Disease | Congenital disorder of glycosylation 2D (CDG2D) [MIM |
| Function | The Golgi complex form catalyzes the production of lactose in the lactating mammary gland and could also be responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. |
| Function | The cell surface form functions as a recognition molecule during a variety of cell to cell and cell to matrix interactions, as those occurring during development and egg fertilization, by binding to specific oligosaccharide ligands on opposing cells or in the extracellular matrix. |
| Pathway | Protein modification; protein glycosylation. |
| Ptm | The soluble form derives from the membrane forms by proteolytic processing. |
| Similarity | Belongs to the glycosyltransferase 7 family. |
| Subcellular Location | Isoform Long: Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Cell membrane; Single-pass type II membrane protein. Cell surface. Note=Found in trans cisternae of Golgi. |
| Subcellular Location | Isoform Short: Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Found in trans cisternae of Golgi. |
| Subcellular Location | Processed beta-1,4-galactosyltransferase 1: Secreted. Note=Soluble form found in body fluids. |
| Subunit | Homodimer; and heterodimer with alpha-lactalbumin to form lactose synthase. {ECO |
| Tissue Specificity | Ubiquitously expressed, but at very low levels in fetal and adult brain. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Beta-1,4-galactosyltransferase 1; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_436"; |
| Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=B4GALT1"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP002816 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 13929462 | RefSeq | NP_001488 | 398 | beta-1,4-galactosyltransferase 1 |
Identical Sequences to LMP002816 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13929462 | GenBank | AED39172.1 | 398 | Sequence 1153 from patent US 7883858 |
| GI:13929462 | GenBank | AEU51299.1 | 398 | Sequence 2 from patent US 8058508 |
| GI:13929462 | GenBank | AFC00573.1 | 398 | Sequence 10 from patent US 8119770 |
| GI:13929462 | GenBank | AGF19291.1 | 398 | Sequence 16 from patent US 8367374 |
| GI:13929462 | GenBank | AGU07400.1 | 398 | Sequence 10 from patent US 8481487 |
| GI:13929462 | GenBank | AHD80055.1 | 398 | Sequence 31520 from patent US 8586006 |
Related Sequences to LMP002816 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13929462 | EMBL | CAA31611.1 | 398 | N-acetylglucosamide-(beta 1-4)-galactosyltransferase [Homo sapiens] |
| GI:13929462 | EMBL | CAA02401.1 | 767 | GALACTOSYLTRANSFERASE-SIALYLTRANSFERASE HYBRID PROTEIN [unidentified] |
| GI:13929462 | EMBL | CAA02402.1 | 767 | GALACTOSYLTRANSFERASE-SIALYLTRANSFERASE HYBRID PROTEIN [unidentified] |
| GI:13929462 | pat | US | 767 | Sequence 6 from patent US 5641668 |
| GI:13929462 | pat | US | 767 | Sequence 8 from patent US 5641668 |
| GI:13929462 | RefSeq | XP_004047969.1 | 398 | PREDICTED: beta-1,4-galactosyltransferase 1 [Gorilla gorilla gorilla] |