Gene/Proteome Database (LMPD)
LMPD ID
LMP002825
Gene ID
Species
Homo sapiens (Human)
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
Gene Symbol
Synonyms
ATP5A; ATP5G
Alternate Names
ATP synthase F(0) complex subunit C1, mitochondrial; ATPase protein 9; ATPase subunit 9; ATPase subunit C; ATP synthase proteolipid P1; mitochondrial ATP synthase, subunit 9, isoform 1; mitochondrial ATP synthase, subunit C, isoform 1; ATP synthase lipid-binding protein, mitochondrial; ATP synthase proton-transporting mitochondrial F(0) complex subunit C1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1
Chromosome
17
Map Location
17q21.32
Summary
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| ATP synthase F(0) complex subunit C1, mitochondrial precursor | |
|---|---|
| Refseq ID | NP_005166 |
| Protein GI | 4885081 |
| UniProt ID | P05496 |
| mRNA ID | NM_005175 |
| Length | 136 |
| RefSeq Status | REVIEWED |
| MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
| transit_peptide: 1..61 calculated_mol_wt: 6687 peptide sequence: MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSR mat_peptide: 62..136 product: ATP synthase F(0) complex subunit C1, mitochondrial calculated_mol_wt: 7608 peptide sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM transit_peptide: 1..61 calculated_mol_wt: 6687 peptide sequence: MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSR mat_peptide: 62..136 product: ATP synthase F(0) complex subunit C1, mitochondrial calculated_mol_wt: 7608 peptide sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
| ATP synthase F(0) complex subunit C1, mitochondrial precursor | |
|---|---|
| Refseq ID | NP_001002027 |
| Protein GI | 50659069 |
| UniProt ID | P05496 |
| mRNA ID | NM_001002027 |
| Length | 136 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:4885081 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005743 | TAS:Reactome | C | mitochondrial inner membrane |
| GO:0005753 | ISS:UniProtKB | C | mitochondrial proton-transporting ATP synthase complex |
| GO:0005739 | IDA:LIFEdb | C | mitochondrion |
| GO:0045263 | IEA:UniProtKB-KW | C | proton-transporting ATP synthase complex, coupling factor F(o) |
| GO:0015078 | IEA:InterPro | F | hydrogen ion transmembrane transporter activity |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0005215 | NAS:ProtInc | F | transporter activity |
| GO:0015991 | IEA:InterPro | P | ATP hydrolysis coupled proton transport |
| GO:0044237 | TAS:Reactome | P | cellular metabolic process |
| GO:0042776 | TAS:Reactome | P | mitochondrial ATP synthesis coupled proton transport |
| GO:0022904 | TAS:Reactome | P | respiratory electron transport chain |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa05010 | Alzheimer's disease |
| hsa05016 | Huntington's disease |
| hsa05012 | Parkinson's disease |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_118595 | Mitochondrial protein import |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
Protein Entry
AT5G1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. |
| Miscellaneous | There are three genes which encode the mitochondrial ATP synthase proteolipid and they specify precursors with different import sequences but identical mature proteins. Is the major protein stored in the storage bodies of animals or humans affected with ceroid lipofuscinosis (Batten disease). |
| Similarity | Belongs to the ATPase C chain family. |
| Subcellular Location | Mitochondrion membrane; Multi-pass membrane protein. |
| Subunit | F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Component of an ATP synthase complex composed of ATP5F1, ATP5G1, ATP5E, ATP5H, ATP5I, ATP5J, ATP5J2, MT-ATP6, MT-ATP8, ATP5A1, ATP5B, ATP5D, ATP5C1, ATP5O, ATP5L, USMG5 and MP68 (By similarity). |
Identical and Related Proteins
Unique RefSeq proteins for LMP002825 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4885081 | RefSeq | NP_005166 | 136 | ATP synthase F(0) complex subunit C1, mitochondrial precursor |
Identical Sequences to LMP002825 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4885081 | GenBank | JAA11991.1 | 136 | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Pan troglodytes] |
| GI:4885081 | GenBank | JAA29091.1 | 136 | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Pan troglodytes] |
| GI:4885081 | GenBank | JAA40605.1 | 136 | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Pan troglodytes] |
| GI:4885081 | RefSeq | XP_003780153.1 | 136 | PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial [Pongo abelii] |
| GI:4885081 | RefSeq | XP_003827560.1 | 136 | PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial [Pan paniscus] |
| GI:4885081 | RefSeq | XP_003827561.1 | 136 | PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial [Pan paniscus] |
Related Sequences to LMP002825 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4885081 | GenBank | AAP36635.1 | 137 | Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, partial [synthetic construct] |
| GI:4885081 | GenBank | AAX43922.1 | 137 | ATP synthase H+ transporting mitochondrial F0 complex subunit c isoform 1, partial [synthetic construct] |
| GI:4885081 | GenBank | AAX43923.1 | 137 | ATP synthase H+ transporting mitochondrial F0 complex subunit c isoform 1, partial [synthetic construct] |
| GI:4885081 | GenBank | ACM83953.1 | 161 | Sequence 9451 from patent US 6812339 |
| GI:4885081 | GenBank | AIC54052.1 | 136 | ATP5G1, partial [synthetic construct] |
| GI:4885081 | RefSeq | XP_004041457.1 | 136 | PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Gorilla gorilla gorilla] |