Gene/Proteome Database (LMPD)

LMPD ID
LMP002855
Gene ID
20441
Species
Mus musculus (Mouse)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 3
Gene Symbol
St3gal3
Synonyms
ST3GalIII; ST3N; Siat3; Siat6
Alternate Names
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; alpha 2,3-ST 3; sialyltransferase 3; beta-galactoside alpha-2,3-sialyltransferase 3; N-acetyllactosaminide alpha-2,3-sialyltransferase; gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase)
Chromosome
4
Map Location
4|4 D1
EC Number
2.4.99.6

Proteins

CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform a
Refseq ID NP_033202
Protein GI 239937469
UniProt ID P97325
mRNA ID NM_009176
Length 374
RefSeq Status VALIDATED
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLLLSLDSAGQTLGTEYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFERDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform a
Refseq ID NP_001272449
Protein GI 550822400
UniProt ID P97325
mRNA ID NM_001285520
Length 374
RefSeq Status VALIDATED
Protein sequence is identical to GI:239937469 (mRNA isoform)
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform a
Refseq ID NP_001155246
Protein GI 239937471
UniProt ID P97325
mRNA ID NM_001161774
Length 374
RefSeq Status VALIDATED
Protein sequence is identical to GI:239937469 (mRNA isoform)
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform b
Refseq ID NP_001272450
Protein GI 550822052
UniProt ID Q9CZ48
mRNA ID NM_001285521
Length 358
RefSeq Status VALIDATED
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSKYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFERDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

Gene Information

Entrez Gene ID
20441
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 3
Gene Symbol
St3gal3
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0008118 IEA:UniProtKB-EC F N-acetyllactosaminide alpha-2,3-sialyltransferase activity
GO:0003836 IDA:MGI F beta-galactoside (CMP) alpha-2,3-sialyltransferase activity
GO:0006486 IDA:MGI P protein glycosylation
GO:0097503 IDA:GOC P sialylation

KEGG Pathway Links

KEGG Pathway ID Description
mmu00533 Glycosaminoglycan biosynthesis - keratan sulfate
mmu00514 Other types of O-glycan biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5893854 Keratan sulfate biosynthesis
5894035 Pre-NOTCH Processing in Golgi

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 3
Protein Entry
Q9CZ48_MOUSE
UniProt ID
Q9CZ48
Species
Mouse

Comments

Comment Type Description
Catalytic Activity CMP-N-acetylneuraminate + beta-D-galactosyl- (1->4)-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N- acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-D- glucosaminyl-glycoprotein.
Developmental Stage Developmental regulation only occurs in liver, heart, kidney and spleen.
Function Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta- 1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- or NeuAc-alpha- 2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3- GalNAc.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 29 family. {ECO:0000305}.
Subcellular Location Membrane; Single-pass type II membrane protein. Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein.
Tissue Specificity Found in all tissues tested. High expression found in brain, liver, kidney, colon, heart and spleen.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=ST3Gal III; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_644";

Identical and Related Proteins

Unique RefSeq proteins for LMP002855 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
239937469 RefSeq NP_033202 374 CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform a
550822052 RefSeq NP_001272450 358 CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform b

Identical Sequences to LMP002855 proteins

Reference Database Accession Length Protein Name
GI:550822052 DBBJ BAB28598.1 358 unnamed protein product [Mus musculus]
GI:239937469 GenBank AAH06710.1 374 St3gal3 protein [Mus musculus]
GI:239937469 GenBank EDL30520.1 374 ST3 beta-galactoside alpha-2,3-sialyltransferase 3, isoform CRA_a [Mus musculus]
GI:550822052 GenBank EDL30521.1 358 ST3 beta-galactoside alpha-2,3-sialyltransferase 3, isoform CRA_b [Mus musculus]
GI:239937469 GenBank EDL30522.1 374 ST3 beta-galactoside alpha-2,3-sialyltransferase 3, isoform CRA_a [Mus musculus]
GI:239937469 RefSeq NP_001155246.1 374 CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform a [Mus musculus]
GI:239937469 RefSeq NP_001272449.1 374 CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform a [Mus musculus]
GI:550822052 RefSeq XP_006502961.1 358 PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X9 [Mus musculus]
GI:239937469 SwissProt P97325.2 374 RecName: Full=CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; AltName: Full=Beta-galactoside alpha-2,3-sialyltransferase 3; Short=Alpha 2,3-ST 3; AltName: Full=Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase; AltName: Full=N-acetyllactosaminide alpha-2,3-sialyltransferase; AltName: Full=ST3Gal III; Short=ST3GalIII; AltName: Full=ST3N; AltName: Full=Sialyltransferase 6 [Mus musculus]

Related Sequences to LMP002855 proteins

Reference Database Accession Length Protein Name
GI:239937469 DBBJ BAB23779.1 374 unnamed protein product [Mus musculus]
GI:239937469 DBBJ BAE22980.1 374 unnamed protein product [Mus musculus]
GI:239937469 GenBank ERE85107.1 515 CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform 1 [Cricetulus griseus]
GI:550822052 RefSeq XP_004591543.1 358 PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X2 [Ochotona princeps]
GI:550822052 RefSeq XP_004647673.1 358 PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X4 [Octodon degus]
GI:239937469 RefSeq XP_005083945.1 374 PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X6 [Mesocricetus auratus]
GI:550822052 RefSeq XP_005083947.1 358 PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X8 [Mesocricetus auratus]
GI:239937469 RefSeq XP_005370111.1 380 PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X1 [Microtus ochrogaster]
GI:239937469 RefSeq XP_005370112.1 380 PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X2 [Microtus ochrogaster]
GI:550822052 RefSeq XP_005370113.1 364 PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X3 [Microtus ochrogaster]
GI:550822052 RefSeq XP_006238778.1 358 PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X2 [Rattus norvegicus]
GI:550822052 RefSeq XP_007617378.1 358 PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X4 [Cricetulus griseus]