Gene/Proteome Database (LMPD)
LMPD ID
LMP002877
Gene ID
Species
Homo sapiens (Human)
Gene Name
progestin and adipoQ receptor family member VII
Gene Symbol
Synonyms
MPRA; PGLP; mSR
Alternate Names
membrane progestin receptor alpha; mPR alpha; 2310021M12Rik; progestin and adipoQ receptor family member 7
Chromosome
1
Map Location
1p36.11
Proteins
membrane progestin receptor alpha | |
---|---|
Refseq ID | NP_848509 |
Protein GI | 30410020 |
UniProt ID | Q86WK9 |
mRNA ID | NM_178422 |
Length | 346 |
RefSeq Status | VALIDATED |
MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAFLAWLSCIGSCYNKYIQKPGLLGRTCQEVPSVLAYALDISPVVHRIFVSSDPTTDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK |
Gene Information
Entrez Gene ID
Gene Name
progestin and adipoQ receptor family member VII
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005886 | IBA:RefGenome | C | plasma membrane |
GO:0005496 | IBA:RefGenome | F | steroid binding |
GO:0003707 | IBA:RefGenome | F | steroid hormone receptor activity |
GO:0007275 | IEA:UniProtKB-KW | P | multicellular organismal development |
GO:0048477 | IEA:UniProtKB-KW | P | oogenesis |
GO:0048545 | IBA:RefGenome | P | response to steroid hormone |
GO:0043401 | IBA:GOC | P | steroid hormone mediated signaling pathway |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR004254 | AdipoR/Haemolysin-III-related |
UniProt Annotations
Entry Information
Gene Name
progestin and adipoQ receptor family member VII
Protein Entry
MPRA_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Function | Steroid membrane receptor. Binds progesterone in vitro. May be involved in oocyte maturation. |
Similarity | Belongs to the ADIPOR family. |
Subcellular Location | Cell membrane ; Multi-pass membrane protein . |
Tissue Specificity | Expressed in a wide range of tissues including ovary, testis, placenta, uterus and bladder. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002877 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
30410020 | RefSeq | NP_848509 | 346 | membrane progestin receptor alpha |
Identical Sequences to LMP002877 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30410020 | GenBank | EAX07862.1 | 346 | hCG1642829 [Homo sapiens] |
GI:30410020 | GenBank | AED04639.1 | 346 | Sequence 174 from patent US 7875424 |
GI:30410020 | GenBank | AHD79514.1 | 346 | Sequence 29158 from patent US 8586006 |
GI:30410020 | RefSeq | XP_005245802.1 | 346 | PREDICTED: membrane progestin receptor alpha isoform X1 [Homo sapiens] |
GI:30410020 | RefSeq | XP_005245803.1 | 346 | PREDICTED: membrane progestin receptor alpha isoform X2 [Homo sapiens] |
GI:30410020 | RefSeq | XP_006710459.1 | 346 | PREDICTED: membrane progestin receptor alpha isoform X3 [Homo sapiens] |
Related Sequences to LMP002877 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30410020 | EMBL | CAD69865.1 | 502 | unnamed protein product [Homo sapiens] |
GI:30410020 | GenBank | JAA05562.1 | 346 | progestin and adipoQ receptor family member VII [Pan troglodytes] |
GI:30410020 | GenBank | JAA19529.1 | 346 | progestin and adipoQ receptor family member VII [Pan troglodytes] |
GI:30410020 | GenBank | JAA32255.1 | 346 | progestin and adipoQ receptor family member VII [Pan troglodytes] |
GI:30410020 | GenBank | JAA33921.1 | 346 | progestin and adipoQ receptor family member VII [Pan troglodytes] |
GI:30410020 | RefSeq | XP_001136453.1 | 346 | PREDICTED: membrane progestin receptor alpha [Pan troglodytes] |