Gene/Proteome Database (LMPD)

LMPD ID
LMP002923
Gene ID
Species
Mus musculus (Mouse)
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 6
Gene Symbol
Synonyms
D19210
Alternate Names
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6; 3beta-HSD VI; 3-beta-HSD VI; hydroxysteroid dehydrogenase-6, delta<5>-3-beta; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type VI; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 6 pseudogene
Chromosome
3
Map Location
3 F2.2|3
EC Number
1.1.1.-

Proteins

3 beta-hydroxysteroid dehydrogenase/Delta 5--&gt;4-isomerase type 6
Refseq ID NP_038849
Protein GI 162461883
UniProt ID O35469
mRNA ID NM_013821
Length 373
RefSeq Status VALIDATED
MPGWSCLVTGAGGFLGQRIVQLLMQEKDLEEIRVLDKFFRPETREQFFNLDTNIKVTVLEGDILDTQYLRKACQGISVVIHTAAVIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFIFSSSVDVAGPNSYKEIILNGNEEEHHESIWSDPYPYSKKMAEKAVLAANGSMLKIGGTLHTCALRPMYIYGERSPFISNTIITALKNKNILGCTGKFSTANPVYVGNVAWAHILAARGLRDPKKSPNIQGEFYYISDDTPHQSYDDLNYTLSKEWGFCPDSSWSLPVPLLYWLAFMLETVSFLLSPIYRFIPPFNRHLVTLTGSTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ

Gene Information

Entrez Gene ID
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 6
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0003854 IEA:UniProtKB-EC F 3-beta-hydroxy-delta5-steroid dehydrogenase activity
GO:0004769 IEA:UniProtKB-EC F steroid delta-isomerase activity
GO:0006694 IEA:UniProtKB-UniPathway P steroid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu04913 Ovarian steroidogenesis
mmu00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002225 3-beta hydroxysteroid dehydrogenase/isomerase
IPR016040 NAD(P)-binding domain

UniProt Annotations

Entry Information

Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 6
Protein Entry
3BHS6_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity A 3-beta-hydroxy-Delta(5)-steroid + NAD(+) = a 3-oxo-Delta(5)-steroid + NADH.
Catalytic Activity A 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)- steroid.
Developmental Stage Earliest isoform to be expressed during embryogenesis in cells of embryonic origin at 7 and 9.5 dpc, and is the major isoform expressed in uterine tissue at the time of implantation (4.5 dpc) and continues to be expressed in uterine tissue at 6.5, 7.5 and 9.5 dpc. It is expressed in giant trophoblasts at 9.5 dpc and is expressed in the placenta through 15.5 dpc.
Function 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. May be involved in local production of progesterone.
Pathway Lipid metabolism; steroid biosynthesis.
Similarity Belongs to the 3-beta-HSD family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity Expressed in skin and testis.

Identical and Related Proteins

Unique RefSeq proteins for LMP002923 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
162461883 RefSeq NP_038849 373 3 beta-hydroxysteroid dehydrogenase/Delta 5--&gt;4-isomerase type 6

Identical Sequences to LMP002923 proteins

Reference Database Accession Length Protein Name
GI:162461883 DBBJ BAE25002.1 373 unnamed protein product [Mus musculus]
GI:162461883 GenBank EDL38971.1 373 mCG19918 [Mus musculus]
GI:162461883 SwissProt O35469.4 373 RecName: Full=3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6; AltName: Full=3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type VI; Short=3-beta-HSD VI; Includes: RecName: Full=3-beta-hydroxy-Delta(5)-steroid dehydrogenase; AltName: Full=3-beta-hydroxy-5-ene steroid dehydrogenase; AltName: Full=Progesterone reductase; Includes: RecName: Full=Steroid Delta-isomerase; AltName: Full=Delta-5-3-ketosteroid isomerase [Mus musculus]

Related Sequences to LMP002923 proteins

Reference Database Accession Length Protein Name
GI:162461883 DBBJ BAD05114.1 373 3beta-hydroxysteroid dehydrogenase VI [Mus musculus]
GI:162461883 GenBank AAB84299.1 373 3beta-hydroxysteroid dehydrogenase isoform VI [Mus musculus]
GI:162461883 GenBank AAL02366.1 373 3 beta-hydroxysteroid dehydrogenase isomerase VI [Mus musculus]
GI:162461883 GenBank AAH53501.1 373 Hsd3b6 protein [Mus musculus]
GI:162461883 RefSeq NP_694873.2 373 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 [Mus musculus]
GI:162461883 SwissProt P26149.4 373 RecName: Full=3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; AltName: Full=3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; Short=3-beta-HSD II; Includes: RecName: Full=3-beta-hydroxy-Delta(5)-steroid dehydrogenase; AltName: Full=3-beta-hydroxy-5-ene steroid dehydrogenase; AltName: Full=Progesterone reductase; Includes: RecName: Full=Steroid Delta-isomerase; AltName: Full=Delta-5-3-ketosteroid isomerase [Mus musculus]