Gene/Proteome Database (LMPD)

LMPD ID
LMP002939
Gene ID
20494
Species
Mus musculus (Mouse)
Gene Name
solute carrier family 10, member 2
Gene Symbol
Slc10a2
Synonyms
ASBT; ISBT
Alternate Names
ileal sodium/bile acid cotransporter; IBAT; ileal Na(+)/bile acid cotransporter; Na(+)-dependent ileal bile acid transporter; ileal sodium-dependent bile acid transporter; apical sodium-dependent bile acid transporter; sodium/taurocholate cotransporting polypeptide, ileal
Chromosome
8
Map Location
8 A1.1|8 2.16 cM

Proteins

ileal sodium/bile acid cotransporter
Refseq ID NP_035518
Protein GI 6755530
UniProt ID P70172
mRNA ID NM_011388
Length 348
RefSeq Status PROVISIONAL
MDNSSVCPPNATVCEGDSCVVPESNFNAILNTVMSTVLTILLAMVMFSMGCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGMFVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIEPKLWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVFAAVILGIYVTYRKCYGKNDAEFLEKTDNEMDSRPSFDETNKGFQPDEK

Gene Information

Entrez Gene ID
20494
Gene Name
solute carrier family 10, member 2
Gene Symbol
Slc10a2
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016324 IDA:MGI C apical plasma membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005902 IDA:MGI C microvillus
GO:0005634 IEA:Ensembl C nucleus
GO:0000502 IEA:Ensembl C proteasome complex
GO:0008508 IEA:InterPro F bile acid:sodium symporter activity

KEGG Pathway Links

KEGG Pathway ID Description
ko04976 Bile secretion
mmu04976 Bile secretion

REACTOME Pathway Links

REACTOME Pathway ID Description
5893230 Bile acid and bile salt metabolism
5893229 Recycling of bile acids and salts

Domain Information

InterPro Annotations

Accession Description
IPR004710 Bile acid:sodium symporter
IPR002657 Bile acid:sodium symporter/arsenical resistance protein Acr3

UniProt Annotations

Entry Information

Gene Name
solute carrier family 10, member 2
Protein Entry
NTCP2_MOUSE
UniProt ID
P70172
Species
Mouse

Comments

Comment Type Description
Function Plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine. Plays a key role in cholesterol metabolism (By similarity). {ECO:0000250}.
Similarity Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Subunit Monomer and homodimer. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002939 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6755530 RefSeq NP_035518 348 ileal sodium/bile acid cotransporter

Identical Sequences to LMP002939 proteins

Reference Database Accession Length Protein Name
GI:6755530 DBBJ BAA19606.1 348 ISBT [Mus musculus]
GI:6755530 GenBank AAS20611.1 348 solute carrier family 10, member 2 [Mus musculus]
GI:6755530 GenBank AAI20704.1 348 Solute carrier family 10, member 2 [Mus musculus]
GI:6755530 GenBank AAI25291.1 348 Solute carrier family 10, member 2 [Mus musculus]
GI:6755530 GenBank EDL22015.1 348 solute carrier family 10, member 2 [Mus musculus]
GI:6755530 SwissProt P70172.2 348 RecName: Full=Ileal sodium/bile acid cotransporter; AltName: Full=Apical sodium-dependent bile acid transporter; Short=ASBT; AltName: Full=Ileal Na(+)/bile acid cotransporter; AltName: Full=Ileal sodium-dependent bile acid transporter; Short=IBAT; Short=ISBT; AltName: Full=Na(+)-dependent ileal bile acid transporter; AltName: Full=Sodium/taurocholate cotransporting polypeptide, ileal; AltName: Full=Solute carrier family 10 member 2 [Mus musculus]

Related Sequences to LMP002939 proteins

Reference Database Accession Length Protein Name
GI:6755530 GenBank AAC53101.1 348 ileal sodium-dependent bile acid transporter [Rattus norvegicus]
GI:6755530 GenBank AAK55514.1 348 ileal sodium-dependent bile acid transporter [Mus musculus]
GI:6755530 GenBank AAS20612.1 348 solute carrier family 10, member 2 [Mus musculus]
GI:6755530 PRF - 348 Na-dependent bile acid transporter [Rattus norvegicus]
GI:6755530 RefSeq NP_058918.1 348 ileal sodium/bile acid cotransporter [Rattus norvegicus]
GI:6755530 SwissProt Q62633.1 348 RecName: Full=Ileal sodium/bile acid cotransporter; AltName: Full=Apical sodium-dependent bile acid transporter; Short=ASBT; AltName: Full=Ileal Na(+)/bile acid cotransporter; AltName: Full=Ileal sodium-dependent bile acid transporter; Short=IBAT; Short=ISBT; AltName: Full=Na(+)-dependent ileal bile acid transporter; AltName: Full=Sodium/taurocholate-cotransporting polypeptide, ileal; AltName: Full=Solute carrier family 10 member 2 [Rattus norvegicus]