Gene/Proteome Database (LMPD)
LMPD ID
LMP002947
Gene ID
Species
Homo sapiens (Human)
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Gene Symbol
Synonyms
B4Gal-T2; B4Gal-T3; beta4Gal-T2
Alternate Names
beta-1,4-galactosyltransferase 2; beta-4-GalT2; beta-1,4-GalTase 2; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2; beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2
Chromosome
1
Map Location
1p34-p33
EC Number
2.4.1.-
Summary
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene synthesizes N-acetyllactosamine in glycolipids and glycoproteins. Its substrate specificity is affected by alpha-lactalbumin but it is not expressed in lactating mammary tissue. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]
Orthologs
Proteins
| beta-1,4-galactosyltransferase 2 isoform a | |
|---|---|
| Refseq ID | NP_085076 |
| Protein GI | 339276013 |
| UniProt ID | O60909 |
| mRNA ID | NM_030587 |
| Length | 401 |
| RefSeq Status | REVIEWED |
| MAVEVQEQWPCLPAAGCPGPLGGPVAACGMSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASSSSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG | |
| beta-1,4-galactosyltransferase 2 isoform b | |
|---|---|
| Refseq ID | NP_003771 |
| Protein GI | 4502347 |
| UniProt ID | O60909 |
| mRNA ID | NM_003780 |
| Length | 372 |
| RefSeq Status | REVIEWED |
| MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASSSSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG | |
| beta-1,4-galactosyltransferase 2 isoform b | |
|---|---|
| Refseq ID | NP_001005417 |
| Protein GI | 53759113 |
| UniProt ID | O60909 |
| mRNA ID | NM_001005417 |
| Length | 372 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:4502347 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000139 | TAS:Reactome | C | Golgi membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003945 | IEA:UniProtKB-EC | F | N-acetyllactosamine synthase activity |
| GO:0003831 | IEA:UniProtKB-EC | F | beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity |
| GO:0008378 | TAS:ProtInc | F | galactosyltransferase activity |
| GO:0004461 | IEA:UniProtKB-EC | F | lactose synthase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0005975 | TAS:Reactome | P | carbohydrate metabolic process |
| GO:0044267 | TAS:Reactome | P | cellular protein metabolic process |
| GO:0030203 | TAS:Reactome | P | glycosaminoglycan metabolic process |
| GO:0018146 | TAS:Reactome | P | keratan sulfate biosynthetic process |
| GO:0042339 | TAS:Reactome | P | keratan sulfate metabolic process |
| GO:0043687 | TAS:Reactome | P | post-translational protein modification |
| GO:0018279 | TAS:Reactome | P | protein N-linked glycosylation via asparagine |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00533 | Glycosaminoglycan biosynthesis - keratan sulfate |
| hsa00510 | N-Glycan biosynthesis |
| hsa00514 | Other types of O-glycan biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121120 | Keratan sulfate biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Protein Entry
B4GT2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O60909-1; Sequence=Displayed; Name=2; IsoId=O60909-2; Sequence=VSP_014103, VSP_014104; Note=No experimental confirmation available.; Name=3; IsoId=O60909-3; Sequence=VSP_043010; Note=No experimental confirmation available.; |
| Biophysicochemical Properties | Kinetic parameters: KM=71 uM for GlcNAc-B-S-pNP ; |
| Catalytic Activity | UDP-alpha-D-galactose + D-glucose = UDP + lactose. |
| Catalytic Activity | UDP-alpha-D-galactose + N-acetyl-D-glucosamine = UDP + N-acetyllactosamine. |
| Catalytic Activity | UDP-alpha-D-galactose + N-acetyl-beta-D- glucosaminylglycopeptide = UDP + beta-D-galactosyl-(1->4)-N- acetyl-beta-D-glucosaminylglycopeptide. |
| Cofactor | Name=Mn(2+); Xref=ChEBI |
| Function | Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. Can produce lactose. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 7 family. |
| Subcellular Location | Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Trans cisternae of Golgi stack. |
| Tissue Specificity | Weakly expressed in various tissues. Highest expression in prostate, testis, ovary, intestine, muscle, and in fetal brain. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Beta-1,4-galactosyltransferase 2; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_437"; |
| Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=B4GALT2"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP002947 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 339276013 | RefSeq | NP_085076 | 401 | beta-1,4-galactosyltransferase 2 isoform a |
| 4502347 | RefSeq | NP_003771 | 372 | beta-1,4-galactosyltransferase 2 isoform b |
Identical Sequences to LMP002947 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:339276013 | DBBJ | BAG56925.1 | 401 | unnamed protein product [Homo sapiens] |
| GI:4502347 | GenBank | ACM82569.1 | 372 | Sequence 8067 from patent US 6812339 |
| GI:4502347 | GenBank | AEF64142.1 | 372 | Sequence 137 from patent US 7932032 |
| GI:4502347 | GenBank | AFN90244.1 | 372 | Sequence 137 from patent US 8198025 |
| GI:4502347 | GenBank | AGV95417.1 | 372 | Sequence 6 from patent US 8512991 |
| GI:4502347 | RefSeq | XP_005271361.1 | 372 | PREDICTED: beta-1,4-galactosyltransferase 2 isoform X1 [Homo sapiens] |
| GI:4502347 | RefSeq | XP_006711080.1 | 372 | PREDICTED: beta-1,4-galactosyltransferase 2 isoform X2 [Homo sapiens] |
Related Sequences to LMP002947 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502347 | DBBJ | BAG56925.1 | 401 | unnamed protein product [Homo sapiens] |
| GI:4502347 | GenBank | AAH96821.1 | 372 | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [Homo sapiens] |
| GI:4502347 | GenBank | EHH49852.1 | 401 | hypothetical protein EGM_00579 [Macaca fascicularis] |
| GI:339276013 | GenBank | EHH49852.1 | 401 | hypothetical protein EGM_00579 [Macaca fascicularis] |
| GI:339276013 | GenBank | JAA03819.1 | 401 | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [Pan troglodytes] |
| GI:4502347 | GenBank | JAA03819.1 | 401 | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [Pan troglodytes] |
| GI:339276013 | RefSeq | XP_003308089.1 | 400 | PREDICTED: beta-1,4-galactosyltransferase 2 isoform X1 [Pan troglodytes] |
| GI:4502347 | RefSeq | NP_085076.2 | 401 | beta-1,4-galactosyltransferase 2 isoform a [Homo sapiens] |
| GI:339276013 | RefSeq | XP_003812875.1 | 400 | PREDICTED: beta-1,4-galactosyltransferase 2 isoform X1 [Pan paniscus] |
| GI:339276013 | RefSeq | XP_004025697.1 | 400 | PREDICTED: beta-1,4-galactosyltransferase 2 isoform 3 [Gorilla gorilla gorilla] |
| GI:4502347 | RefSeq | XP_008963567.1 | 371 | PREDICTED: beta-1,4-galactosyltransferase 2 isoform X2 [Pan paniscus] |
| GI:339276013 | RefSeq | XP_010370204.1 | 402 | PREDICTED: beta-1,4-galactosyltransferase 2 isoform X1 [Rhinopithecus roxellana] |