Gene/Proteome Database (LMPD)
LMPD ID
LMP002996
Gene ID
Species
Mus musculus (Mouse)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Synonyms
Siat4c
Alternate Names
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; SIAT4-C; ST3GalIV; ST3Gal IV; alpha 2,3-ST 4; alpha 2,3-sialyltransferase IV; beta-galactoside alpha-2,3-sialyltransferase 4; gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase); sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase)
Chromosome
9
Map Location
9|9 A5.3
EC Number
2.4.99.-
Proteins
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 | |
---|---|
Refseq ID | NP_033204 |
Protein GI | 31543703 |
UniProt ID | Q91Y74 |
mRNA ID | NM_009178 |
Length | 333 |
RefSeq Status | PROVISIONAL |
MTSKSHWKLLALALVLVVVMVWYSISREDRYIEFFYFPISEKKEPCFQGEAERQASKIFGNRSREQPIFLQLKDYFWVKTPSTYELPFGTKGSEDLLLRVLAITSYSIPESIKSLECRRCVVVGNGHRLRNSSLGGVINKYDVVIRLNNAPVAGYEGDVGSKTTIRLFYPESAHFDPKIENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQVRILNPFFMEIAADKLLSLPIQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDASNKKQTIHYYEQITLKSMAGSGHNVSQEAIAIKRMLEMGAVKNLTYF |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
GO:0003836 | IDA:MGI | F | beta-galactoside (CMP) alpha-2,3-sialyltransferase activity |
GO:0047288 | IEA:Ensembl | F | monosialoganglioside sialyltransferase activity |
GO:0050890 | IEA:Ensembl | P | cognition |
GO:0006486 | IDA:MGI | P | protein glycosylation |
GO:0097503 | IDA:GOC | P | sialylation |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Protein Entry
SIA4C_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | CMP-N-acetylneuraminate + beta-D-galactosyl- 1,4-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1,4-N-acetyl-D- glucosaminyl-glycoprotein. |
Function | It may catalyze the formation of the NeuAc-alpha-2,3- Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. {ECO:0000250}. |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 29 family. {ECO:0000305}. |
Subcellular Location | Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Note=Membrane-bound form in trans cisternae of Golgi. {ECO:0000250}. |
Web Resource | Name=Functional Glycomics Gateway - GTase; Note=ST3Gal IV; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_645"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP002996 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
31543703 | RefSeq | NP_033204 | 333 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 |
Identical Sequences to LMP002996 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31543703 | DBBJ | BAB47508.1 | 333 | sialyltransferase [Mus musculus] |
GI:31543703 | GenBank | AAH50773.1 | 333 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Mus musculus] |
GI:31543703 | RefSeq | XP_006510177.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X7 [Mus musculus] |
GI:31543703 | RefSeq | XP_006510178.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X8 [Mus musculus] |
GI:31543703 | RefSeq | XP_006510179.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X9 [Mus musculus] |
GI:31543703 | SwissProt | Q91Y74.1 | 333 | RecName: Full=CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; Short=Alpha 2,3-ST 4; Short=Beta-galactoside alpha-2,3-sialyltransferase 4; AltName: Full=Alpha 2,3-sialyltransferase IV; AltName: Full=Gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; AltName: Full=ST3Gal IV; Short=ST3GalIV; AltName: Full=Sialyltransferase 4C; Short=SIAT4-C [Mus musculus] |
Related Sequences to LMP002996 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31543703 | RefSeq | XP_006510171.1 | 373 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Mus musculus] |
GI:31543703 | RefSeq | XP_006510172.1 | 370 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X2 [Mus musculus] |
GI:31543703 | RefSeq | XP_006510173.1 | 367 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X3 [Mus musculus] |
GI:31543703 | RefSeq | XP_006510174.1 | 365 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X4 [Mus musculus] |
GI:31543703 | RefSeq | XP_006510175.1 | 365 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X5 [Mus musculus] |
GI:31543703 | RefSeq | XP_006510176.1 | 365 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X6 [Mus musculus] |