Gene/Proteome Database (LMPD)

LMPD ID
LMP002996
Gene ID
Species
Mus musculus (Mouse)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Synonyms
Siat4c
Alternate Names
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; SIAT4-C; ST3GalIV; ST3Gal IV; alpha 2,3-ST 4; alpha 2,3-sialyltransferase IV; beta-galactoside alpha-2,3-sialyltransferase 4; gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase); sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase)
Chromosome
9
Map Location
9|9 A5.3
EC Number
2.4.99.-

Proteins

CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
Refseq ID NP_033204
Protein GI 31543703
UniProt ID Q91Y74
mRNA ID NM_009178
Length 333
RefSeq Status PROVISIONAL
MTSKSHWKLLALALVLVVVMVWYSISREDRYIEFFYFPISEKKEPCFQGEAERQASKIFGNRSREQPIFLQLKDYFWVKTPSTYELPFGTKGSEDLLLRVLAITSYSIPESIKSLECRRCVVVGNGHRLRNSSLGGVINKYDVVIRLNNAPVAGYEGDVGSKTTIRLFYPESAHFDPKIENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQVRILNPFFMEIAADKLLSLPIQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDASNKKQTIHYYEQITLKSMAGSGHNVSQEAIAIKRMLEMGAVKNLTYF

Gene Information

Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0003836 IDA:MGI F beta-galactoside (CMP) alpha-2,3-sialyltransferase activity
GO:0047288 IEA:Ensembl F monosialoganglioside sialyltransferase activity
GO:0050890 IEA:Ensembl P cognition
GO:0006486 IDA:MGI P protein glycosylation
GO:0097503 IDA:GOC P sialylation

REACTOME Pathway Links

REACTOME Pathway ID Description
5893854 Keratan sulfate biosynthesis
5893905 N-Glycan antennae elongation
5894035 Pre-NOTCH Processing in Golgi
5893911 Termination of O-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Protein Entry
SIA4C_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity CMP-N-acetylneuraminate + beta-D-galactosyl- 1,4-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1,4-N-acetyl-D- glucosaminyl-glycoprotein.
Function It may catalyze the formation of the NeuAc-alpha-2,3- Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. {ECO:0000250}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 29 family. {ECO:0000305}.
Subcellular Location Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Note=Membrane-bound form in trans cisternae of Golgi. {ECO:0000250}.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=ST3Gal IV; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_645";

Identical and Related Proteins

Unique RefSeq proteins for LMP002996 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
31543703 RefSeq NP_033204 333 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4

Identical Sequences to LMP002996 proteins

Reference Database Accession Length Protein Name
GI:31543703 DBBJ BAB47508.1 333 sialyltransferase [Mus musculus]
GI:31543703 GenBank AAH50773.1 333 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Mus musculus]
GI:31543703 RefSeq XP_006510177.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X7 [Mus musculus]
GI:31543703 RefSeq XP_006510178.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X8 [Mus musculus]
GI:31543703 RefSeq XP_006510179.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X9 [Mus musculus]
GI:31543703 SwissProt Q91Y74.1 333 RecName: Full=CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; Short=Alpha 2,3-ST 4; Short=Beta-galactoside alpha-2,3-sialyltransferase 4; AltName: Full=Alpha 2,3-sialyltransferase IV; AltName: Full=Gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; AltName: Full=ST3Gal IV; Short=ST3GalIV; AltName: Full=Sialyltransferase 4C; Short=SIAT4-C [Mus musculus]

Related Sequences to LMP002996 proteins

Reference Database Accession Length Protein Name
GI:31543703 RefSeq XP_006510171.1 373 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Mus musculus]
GI:31543703 RefSeq XP_006510172.1 370 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X2 [Mus musculus]
GI:31543703 RefSeq XP_006510173.1 367 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X3 [Mus musculus]
GI:31543703 RefSeq XP_006510174.1 365 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X4 [Mus musculus]
GI:31543703 RefSeq XP_006510175.1 365 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X5 [Mus musculus]
GI:31543703 RefSeq XP_006510176.1 365 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X6 [Mus musculus]