Gene/Proteome Database (LMPD)
LMPD ID
LMP002997
Gene ID
Species
Homo sapiens (Human)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 11
Gene Symbol
Synonyms
17-BETA-HSD11; 17-BETA-HSDXI; 17BHSD11; DHRS8; PAN1B; RETSDR2; SDR16C2
Alternate Names
estradiol 17-beta-dehydrogenase 11; CTCL tumor antigen HD-CL-03; CTCL-associated antigen HD-CL-03; dehydrogenase/reductase SDR family member 8; 17-beta-hydroxysteroid dehydrogenase type XI; retinal short-chain dehydrogenase/reductase 2; cutaneous T-cell lymphoma-associated antigen HD-CL-03; short chain dehydrogenase/reductase family 16C, member 2
Chromosome
4
Map Location
4q22.1
EC Number
1.1.1.62
Summary
Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).[supplied by OMIM, Jun 2009]
Orthologs
Proteins
| estradiol 17-beta-dehydrogenase 11 precursor | |
|---|---|
| Refseq ID | NP_057329 |
| Protein GI | 613410229 |
| UniProt ID | Q8NBQ5 |
| mRNA ID | NM_016245 |
| Length | 300 |
| RefSeq Status | VALIDATED |
| MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGYKMKAQ | |
| sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2171 peptide sequence: MKFLLDILLLLPLLIVCSL mat_peptide: 20..300 product: Estradiol 17-beta-dehydrogenase 11 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q8NBQ5.3) calculated_mol_wt: 30811 peptide sequence: ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGYKMKAQ | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 11
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:HGNC | C | cytoplasm |
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0005811 | IDA:UniProtKB | C | lipid particle |
| GO:0004303 | IEA:UniProtKB-EC | F | estradiol 17-beta-dehydrogenase activity |
| GO:0016229 | IDA:HGNC | F | steroid dehydrogenase activity |
| GO:0006710 | IDA:HGNC | P | androgen catabolic process |
| GO:0006694 | IEA:UniProtKB-KW | P | steroid biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY66-380 | estrogen biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 11
Protein Entry
DHB11_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H. |
| Function | Can convert androstan-3-alpha,17-beta-diol (3-alpha- diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione. Tumor- associated antigen in cutaneous T-cell lymphoma. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily. |
| Subcellular Location | Secreted . |
| Tissue Specificity | Present at high level in steroidogenic cells such as syncytiotrophoblasts, sebaceous gland, Leydig cells, and granulosa cells of the dominant follicle and corpus luteum. In lung, it is detected in the ciliated epithelium and in acini of adult trachea, in bronchioles, but not in alveoli. In the eye, it is detected in the nonpigmented epithelium of the ciliary body and, at lower level, in the inner nuclear layer of the retina (at protein level). Widely expressed. Highly expressed in retina, pancreas, kidney, liver, lung, adrenal, small intestine, ovary and heart. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP002997 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 613410229 | RefSeq | NP_057329 | 300 | estradiol 17-beta-dehydrogenase 11 precursor |
Identical Sequences to LMP002997 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:613410229 | GenBank | JAA09120.1 | 300 | hydroxysteroid (17-beta) dehydrogenase 11 [Pan troglodytes] |
| GI:613410229 | GenBank | JAA36225.1 | 300 | hydroxysteroid (17-beta) dehydrogenase 11 [Pan troglodytes] |
| GI:613410229 | GenBank | AGV96398.1 | 300 | Sequence 477 from patent US 8513189 |
| GI:613410229 | GenBank | AGV96399.1 | 300 | Sequence 478 from patent US 8513189 |
| GI:613410229 | GenBank | AHD74518.1 | 300 | Sequence 14535 from patent US 8586006 |
| GI:613410229 | GenBank | AIC56401.1 | 300 | HSD17B11, partial [synthetic construct] |
Related Sequences to LMP002997 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:613410229 | DBBJ | BAC11560.1 | 300 | unnamed protein product [Homo sapiens] |
| GI:613410229 | EMBL | CAC39693.1 | 300 | unnamed protein product [Homo sapiens] |
| GI:613410229 | EMBL | CAI72064.1 | 300 | unnamed protein product [Homo sapiens] |
| GI:613410229 | GenBank | AAW11817.1 | 300 | Sequence 8 from patent US 6808895 |
| GI:613410229 | GenBank | ABL23953.1 | 300 | Sequence 24 from patent US 7129338 |
| GI:613410229 | SwissProt | Q8NBQ5.3 | 300 | RecName: Full=Estradiol 17-beta-dehydrogenase 11; AltName: Full=17-beta-hydroxysteroid dehydrogenase 11; Short=17-beta-HSD 11; Short=17bHSD11; Short=17betaHSD11; AltName: Full=17-beta-hydroxysteroid dehydrogenase XI; Short=17-beta-HSD XI; Short=17betaHSDXI; AltName: Full=Cutaneous T-cell lymphoma-associated antigen HD-CL-03; Short=CTCL-associated antigen HD-CL-03; AltName: Full=Dehydrogenase/reductase SDR family member 8; AltName: Full=Retinal short-chain dehydrogenase/reductase 2; Short=retSDR2; Flags: Precursor [Homo sapiens] |