Gene/Proteome Database (LMPD)
LMPD ID
LMP003004
Gene ID
Species
Mus musculus (Mouse)
Gene Name
solute carrier family 18 (vesicular monoamine), member 2
Gene Symbol
Synonyms
1110037L13Rik; 9330105E13; Vmat2
Alternate Names
synaptic vesicular amine transporter; VAT2; monoamine transporter; vesicular amine transporter 2; solute carrier family 18 member 2; vesicular monoamine transporter 2
Chromosome
19
Map Location
19 D3|19 54.64 cM
Proteins
synaptic vesicular amine transporter | |
---|---|
Refseq ID | NP_766111 |
Protein GI | 27369732 |
UniProt ID | Q8BRU6 |
mRNA ID | NM_172523 |
Length | 517 |
RefSeq Status | VALIDATED |
MALSDLVLLRWLRDSRHSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNTTEIQTARPALTASTSESFHSIFSYYNNSTVFTGNATGGLPGGESPKATTTQHTVTNTTVPPDCPSEDKDLLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFAGFCIMFISTVMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIVVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDIVFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNVQPYPVGDDEESESD |
Gene Information
Entrez Gene ID
Gene Name
solute carrier family 18 (vesicular monoamine), member 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0031045 | IEA:Ensembl | C | dense core granule |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0043025 | IEA:Ensembl | C | neuronal cell body |
GO:0030672 | IEA:Ensembl | C | synaptic vesicle membrane |
GO:0043195 | IEA:Ensembl | C | terminal bouton |
GO:0005275 | IEA:Ensembl | F | amine transmembrane transporter activity |
GO:0008144 | IEA:Ensembl | F | drug binding |
GO:0015238 | IEA:InterPro | F | drug transmembrane transporter activity |
GO:0015222 | IEA:Ensembl | F | serotonin transmembrane transporter activity |
GO:0007568 | IEA:Ensembl | P | aging |
GO:0071242 | IEA:Ensembl | P | cellular response to ammonium ion |
GO:0035690 | IEA:Ensembl | P | cellular response to drug |
GO:0016265 | IMP:MGI | P | death |
GO:0032456 | IEA:Ensembl | P | endocytic recycling |
GO:0042593 | IEA:Ensembl | P | glucose homeostasis |
GO:0030073 | IEA:Ensembl | P | insulin secretion |
GO:0007626 | IMP:MGI | P | locomotory behavior |
GO:0051589 | IEA:Ensembl | P | negative regulation of neurotransmitter transport |
GO:0006836 | IEA:UniProtKB-KW | P | neurotransmitter transport |
GO:0009791 | IMP:MGI | P | post-embryonic development |
GO:0001975 | IMP:MGI | P | response to amphetamine |
GO:0042220 | IEA:Ensembl | P | response to cocaine |
GO:0051412 | IEA:Ensembl | P | response to corticosterone |
GO:0009635 | IEA:Ensembl | P | response to herbicide |
GO:0042594 | IEA:Ensembl | P | response to starvation |
GO:0009636 | IMP:MGI | P | response to toxic substance |
GO:0010043 | IEA:Ensembl | P | response to zinc ion |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
solute carrier family 18 (vesicular monoamine), member 2
Protein Entry
VMAT2_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis (By similarity). {ECO:0000250}. |
Similarity | Belongs to the major facilitator superfamily. Vesicular transporter family. {ECO:0000305}. |
Subcellular Location | Cytoplasmic vesicle membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Subunit | Interacts with SLC6A3. {ECO:0000269|PubMed:19357284}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003004 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
27369732 | RefSeq | NP_766111 | 517 | synaptic vesicular amine transporter |
Identical Sequences to LMP003004 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:27369732 | DBBJ | BAC30887.1 | 517 | unnamed protein product [Mus musculus] |
GI:27369732 | EMBL | CAD88262.1 | 517 | vesicular monoamine transporter 2 [Mus musculus] |
GI:27369732 | SwissProt | Q8BRU6.1 | 517 | RecName: Full=Synaptic vesicular amine transporter; AltName: Full=Monoamine transporter; AltName: Full=Solute carrier family 18 member 2; AltName: Full=Vesicular amine transporter 2; Short=VAT2 [Mus musculus] |
Related Sequences to LMP003004 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:27369732 | DBBJ | BAC28501.1 | 517 | unnamed protein product [Mus musculus] |
GI:27369732 | GenBank | AAA41627.1 | 515 | monoamine transporter [Rattus norvegicus] |
GI:27369732 | GenBank | EDL01823.1 | 527 | solute carrier family 18 (vesicular monoamine), member 2, partial [Mus musculus] |
GI:27369732 | GenBank | EDL94557.1 | 515 | solute carrier family 18 (vesicular monoamine), member 2, isoform CRA_a [Rattus norvegicus] |
GI:27369732 | RefSeq | NP_037163.1 | 515 | synaptic vesicular amine transporter [Rattus norvegicus] |
GI:27369732 | RefSeq | XP_006231726.1 | 515 | PREDICTED: synaptic vesicular amine transporter isoform X1 [Rattus norvegicus] |