Gene/Proteome Database (LMPD)
LMPD ID
LMP003007
Gene ID
Species
Mus musculus (Mouse)
Gene Name
glycerophosphodiester phosphodiesterase domain containing 5
Gene Symbol
Synonyms
BC024955; Gde2
Alternate Names
glycerophosphodiester phosphodiesterase domain-containing protein 5; glycerophosphodiester phosphodiesterase 2
Chromosome
7
Map Location
7 E2|7
EC Number
3.1.-.-
Proteins
| glycerophosphodiester phosphodiesterase domain-containing protein 5 | |
|---|---|
| Refseq ID | NP_958740 |
| Protein GI | 52345431 |
| UniProt ID | Q640M6 |
| mRNA ID | NM_201352 |
| Length | 607 |
| RefSeq Status | PROVISIONAL |
| MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLVCTFSLTLTWLYFWWGVHNDYDEFNWYLYNRMGYWSDWSVPILVTSAAAFTYIAGLLVLALCHIAVGQQLNLHWIHKMGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHIGALVAITALSWIVAGQFARAERSSSQLTILCTFFAVVFTFYLIPLTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTVMSFRKALEQRLYGLQADITISLDGVPFLMHDTTLRRTTNVEHLFPELARRPAAMLNWTVLQRLNAGQWFLKTDPFWTASSLSPSDHREVQNQSICSLAELLELAKGNASLLLNLRDPPRDHPYRGSFLNVTLEAVLRSGFPQHQVMWLFNRQRPLVRKMAPGFQQTSGSKEAIANLRKGHIQKLNLRYTQVSHQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHTLSRVPSPLWIMPPDEYCLMWVTADLISFSLIIGIFVLQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDELSVCSDSSYDTYANANSTATPVGPRNAGSRAKTVTEQSGH | |
Gene Information
Entrez Gene ID
Gene Name
glycerophosphodiester phosphodiesterase domain containing 5
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0042995 | IEA:UniProtKB-KW | C | cell projection |
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | IDA:MGI | C | membrane |
| GO:0008889 | IEA:InterPro | F | glycerophosphodiester phosphodiesterase activity |
| GO:0021895 | IMP:MGI | P | cerebral cortex neuron differentiation |
| GO:0006071 | IEA:InterPro | P | glycerol metabolic process |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
| GO:0045746 | IMP:MGI | P | negative regulation of Notch signaling pathway |
| GO:0031175 | IMP:MGI | P | neuron projection development |
| GO:0045666 | IMP:MGI | P | positive regulation of neuron differentiation |
| GO:0048505 | IMP:MGI | P | regulation of timing of cell differentiation |
| GO:0021522 | IMP:MGI | P | spinal cord motor neuron differentiation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
glycerophosphodiester phosphodiesterase domain containing 5
Protein Entry
GDPD5_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Function | Promotes neurite formation. Cooperates with PRDX1 to drive postmitotic motor neuron differentiation. The glycerophosphodiester phosphodiesterase activity may be required for its role in neuronal differentiation. May contribute to the osmotic regulation of cellular glycerophosphocholine. {ECO:0000269|PubMed:17275818, ECO:0000269|PubMed:18667693}. |
| Induction | Up-regulated during neuronal differentiation by retinoic acid. {ECO:0000269|PubMed:17275818}. |
| Ptm | Intramolecular disulfide bond between Cys-25 and Cys-571 is reduced by PRDX1. {ECO:0000250}. |
| Sequence Caution | Sequence=AAH26428.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
| Similarity | Belongs to the glycerophosphoryl diester phosphodiesterase family. {ECO:0000305}. |
| Similarity | Contains 1 GP-PDE domain. {ECO:0000305}. |
| Subcellular Location | Endomembrane system {ECO:0000305}; Multi- pass membrane protein {ECO:0000305}. Cytoplasm, perinuclear region. Cell projection, growth cone. Note=In a punctate perinuclear pattern. |
| Subunit | Interacts with PRDX1; forms a mixed-disulfide with PRDX1, leading to disrupt intramolecular disulfide bond between Cys-25 and Cys-571. {ECO:0000250}. |
| Tissue Specificity | Detected in brain, lung, heart, kidney and testis. {ECO:0000269|PubMed:15276213}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003007 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 52345431 | RefSeq | NP_958740 | 607 | glycerophosphodiester phosphodiesterase domain-containing protein 5 |
Identical Sequences to LMP003007 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:52345431 | DBBJ | BAE24577.1 | 607 | unnamed protein product [Mus musculus] |
| GI:52345431 | DBBJ | BAE32819.1 | 607 | unnamed protein product [Mus musculus] |
| GI:52345431 | GenBank | AAH82585.1 | 607 | Glycerophosphodiester phosphodiesterase domain containing 5 [Mus musculus] |
| GI:52345431 | GenBank | EDL16381.1 | 607 | glycerophosphodiester phosphodiesterase domain containing 5, isoform CRA_c [Mus musculus] |
| GI:52345431 | GenBank | EDL16382.1 | 607 | glycerophosphodiester phosphodiesterase domain containing 5, isoform CRA_c [Mus musculus] |
| GI:52345431 | SwissProt | Q640M6.1 | 607 | RecName: Full=Glycerophosphodiester phosphodiesterase domain-containing protein 5; AltName: Full=Glycerophosphodiester phosphodiesterase 2 [Mus musculus] |
Related Sequences to LMP003007 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:52345431 | GenBank | AAH24955.1 | 607 | Glycerophosphodiester phosphodiesterase domain containing 5 [Mus musculus] |
| GI:52345431 | RefSeq | XP_006223483.1 | 605 | PREDICTED: glycerophosphodiester phosphodiesterase domain-containing protein 5 isoform X2 [Rattus norvegicus] |
| GI:52345431 | RefSeq | XP_006229879.1 | 605 | PREDICTED: glycerophosphodiester phosphodiesterase domain-containing protein 5 isoform X2 [Rattus norvegicus] |
| GI:52345431 | RefSeq | XP_006507695.1 | 612 | PREDICTED: glycerophosphodiester phosphodiesterase domain-containing protein 5 isoform X1 [Mus musculus] |
| GI:52345431 | RefSeq | XP_006507696.1 | 612 | PREDICTED: glycerophosphodiester phosphodiesterase domain-containing protein 5 isoform X2 [Mus musculus] |
| GI:52345431 | RefSeq | XP_006507697.1 | 612 | PREDICTED: glycerophosphodiester phosphodiesterase domain-containing protein 5 isoform X3 [Mus musculus] |