Gene/Proteome Database (LMPD)

LMPD ID
LMP003016
Gene ID
5355
Species
Homo sapiens (Human)
Gene Name
proteolipid protein 2 (colonic epithelium-enriched)
Gene Symbol
PLP2
Synonyms
A4; A4LSB
Alternate Names
proteolipid protein 2; intestinal membrane A4 protein; A4 differentiation-dependent protein; differentiation-dependent protein A4
Chromosome
X
Map Location
Xp11.23
Summary
This gene encodes an integral membrane protein that localizes to the endoplasmic reticulum in colonic epithelial cells. The encoded protein can multimerize and may function as an ion channel. A polymorphism in the promoter of this gene may be linked to an increased risk of X-linked mental retardation. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Jan 2010]
Orthologs
View orthologs and multiple alignments for PLP2

Proteins

proteolipid protein 2
Refseq ID NP_002659
Protein GI 4505893
UniProt ID Q04941
mRNA ID NM_002668
Length 152
RefSeq Status REVIEWED
MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

Gene Information

Entrez Gene ID
5355
Gene Name
proteolipid protein 2 (colonic epithelium-enriched)
Gene Symbol
PLP2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 TAS:ProtInc C endoplasmic reticulum
GO:0005789 TAS:ProtInc C endoplasmic reticulum membrane
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 TAS:ProtInc C membrane
GO:0005886 IDA:UniProtKB C plasma membrane
GO:0019956 IPI:UniProtKB F chemokine binding
GO:0015075 TAS:ProtInc F ion transmembrane transporter activity
GO:0006935 NAS:UniProtKB P chemotaxis
GO:0019221 NAS:UniProtKB P cytokine-mediated signaling pathway
GO:0034220 TAS:GOC P ion transmembrane transport
GO:0006811 TAS:ProtInc P ion transport

Domain Information

InterPro Annotations

Accession Description
IPR008253 Marvel domain

UniProt Annotations

Entry Information

Gene Name
proteolipid protein 2 (colonic epithelium-enriched)
Protein Entry
PLP2_HUMAN
UniProt ID
Q04941
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q04941-1; Sequence=Displayed; Name=2; IsoId=Q04941-2; Sequence=VSP_041602;
Function May play a role in cell differentiation in the intestinal epithelium.
Interaction P32246:CCR1; NbExp=3; IntAct=EBI-608347, EBI-608322;
Similarity Contains 1 MARVEL domain. {ECO
Subcellular Location Membrane; Multi-pass membrane protein.
Tissue Specificity Enriched in colonic mucosa. The expression of A4 follows a gradient along the crypto-villus axis with the most abundant message occurring in the lower half of the crypt.

Identical and Related Proteins

Unique RefSeq proteins for LMP003016 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4505893 RefSeq NP_002659 152 proteolipid protein 2

Identical Sequences to LMP003016 proteins

Reference Database Accession Length Protein Name
GI:4505893 DBBJ BAJ21182.1 152 proteolipid protein 2, partial [synthetic construct]
GI:4505893 GenBank ACR85458.1 152 Sequence 17 from patent US 7521195
GI:4505893 GenBank ADS59211.1 152 Sequence 362 from patent US 7807392
GI:4505893 GenBank AEP45456.1 152 Sequence 163 from patent US 8008004
GI:4505893 GenBank AHD69608.1 152 Sequence 622 from patent US 8586006
GI:4505893 GenBank AIC49415.1 152 PLP2, partial [synthetic construct]

Related Sequences to LMP003016 proteins

Reference Database Accession Length Protein Name
GI:4505893 GenBank EHH30720.1 152 Intestinal membrane A4 protein [Macaca mulatta]
GI:4505893 GenBank AFE65032.1 152 proteolipid protein 2 [Macaca mulatta]
GI:4505893 GenBank AFI35600.1 152 proteolipid protein 2 [Macaca mulatta]
GI:4505893 RefSeq NP_001252795.1 152 proteolipid protein 2 [Macaca mulatta]
GI:4505893 RefSeq XP_003917750.1 152 PREDICTED: proteolipid protein 2 [Papio anubis]
GI:4505893 RefSeq XP_010360910.1 152 PREDICTED: proteolipid protein 2 [Rhinopithecus roxellana]