Gene/Proteome Database (LMPD)
Proteins
| secretoglobin family 2B member 20 precursor | |
|---|---|
| Refseq ID | NP_001009952 |
| Protein GI | 154146235 |
| UniProt ID | J3QK77 |
| mRNA ID | NM_001009952 |
| Length | 112 |
| RefSeq Status | VALIDATED |
| MKGTLLLLGLLVTGELSFQTTEACLPFFEGYASVLSGSRVWLYQELQAFNATAEEKVALEKIQDCYSEERIRNILLEPKIMEAMVASPECLSYYGLDNIRSILDYISKLLGE | |
| sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2436 peptide sequence: MKGTLLLLGLLVTGELSFQTTEA mat_peptide: 24..112 product: Secretoglobin family 2B member 20 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9JI02.1) calculated_mol_wt: 10188 peptide sequence: CLPFFEGYASVLSGSRVWLYQELQAFNATAEEKVALEKIQDCYSEERIRNILLEPKIMEAMVASPECLSYYGLDNIRSILDYISKLLGE | |
Gene Information
Entrez Gene ID
Gene Name
secretoglobin, family 2B, member 20
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005615 | IEA:InterPro | C | extracellular space |
Domain Information
UniProt Annotations
Entry Information
Gene Name
secretoglobin, family 2B, member 20
Protein Entry
J3QK77_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP003117 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 154146235 | RefSeq | NP_001009952 | 112 | secretoglobin family 2B member 20 precursor |
Identical Sequences to LMP003117 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:154146235 | GenBank | AAI65961.1 | 112 | Androgen binding protein delta [synthetic construct] |
| GI:154146235 | GenBank | AIQ80439.1 | 112 | ABPBG20 [Mus musculus] |
Related Sequences to LMP003117 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:154146235 | RefSeq | XP_003084726.1 | 113 | PREDICTED: secretoglobin family 2B member 20-like isoform X1 [Mus musculus] |
| GI:154146235 | RefSeq | XP_006544222.1 | 113 | PREDICTED: secretoglobin family 2B member 20-like isoform X1 [Mus musculus] |
| GI:154146235 | RefSeq | XP_006544233.1 | 87 | PREDICTED: secretoglobin family 2B member 20-like isoform X2 [Mus musculus] |
| GI:154146235 | RefSeq | XP_006540231.1 | 87 | PREDICTED: secretoglobin family 2B member 20 isoform X1 [Mus musculus] |
| GI:154146235 | RefSeq | XP_006540276.1 | 87 | PREDICTED: secretoglobin, family 2B, member 19 isoform X1 [Mus musculus] |
| GI:154146235 | RefSeq | XP_006540562.1 | 87 | PREDICTED: secretoglobin family 2B member 20-like isoform X1 [Mus musculus] |