Gene/Proteome Database (LMPD)
Proteins
| steroid receptor RNA activator 1 isoform a | |
|---|---|
| Refseq ID | NP_079567 |
| Protein GI | 257096048 |
| UniProt ID | Q80VJ2 |
| Length | 232 |
| RefSeq Status | VALIDATED |
| MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLTKRVAAPQDGSPRAPETSGPPPVDHPPPSSKASRPPPMGSCPATGVEPPSSPVIESETLIEDVLRPLEQALEDCHGHTKKQVCDDISRRLALLREQWAGGKLSIPVKKRMALLVQELLHHQWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKKSLSSEETKEEKFTVEPENQTIPGFQQPS | |
Gene Information
Entrez Gene ID
Gene Name
steroid receptor RNA activator 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031252 | IDA:MGI | C | cell leading edge |
| GO:0045171 | IEA:Ensembl | C | intercellular bridge |
| GO:0015630 | IEA:Ensembl | C | microtubule cytoskeleton |
| GO:0005634 | ISS:UniProtKB | C | nucleus |
| GO:0005886 | IEA:Ensembl | C | plasma membrane |
| GO:0030529 | ISS:UniProtKB | C | ribonucleoprotein complex |
| GO:0005831 | ISO:MGI | C | steroid hormone aporeceptor complex |
| GO:0005667 | IDA:MGI | C | transcription factor complex |
| GO:0003677 | IDA:MGI | F | DNA binding |
| GO:0030374 | IDA:MGI | F | ligand-dependent nuclear receptor transcription coactivator activity |
| GO:0010861 | IDA:MGI | F | thyroid hormone receptor activator activity |
| GO:0003713 | ISS:UniProtKB | F | transcription coactivator activity |
| GO:0003712 | ISO:MGI | F | transcription cofactor activity |
| GO:0006915 | IEA:UniProtKB-KW | P | apoptotic process |
| GO:0030154 | ISS:UniProtKB | P | cell differentiation |
| GO:0008283 | ISS:UniProtKB | P | cell proliferation |
| GO:2000273 | IDA:GOC | P | positive regulation of receptor activity |
| GO:0045944 | IDA:MGI | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0042981 | ISS:UniProtKB | P | regulation of apoptotic process |
| GO:0006357 | ISO:MGI | P | regulation of transcription from RNA polymerase II promoter |
| GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR009917 | Steroid receptor RNA activator-protein/coat protein complex II, Sec31 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Also mediates transcriptional coactivation of steroid receptors ligand- dependently through the steroid-binding domain (AF-2). Enhances cellular proliferation and differentiation and promotes apoptosis in vivo. May play a role in tumorigenesis (By similarity). |
| Miscellaneous | Appears to be the first example of a new class of functional RNAs also able to encode a protein. |
| Sequence Caution | Sequence=AAH26480.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=AAH26480.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence.; Evidence= ; Sequence=AAH48362.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=BAB24943.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=BAB26893.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=BAE32451.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; |
| Similarity | Belongs to the SRA1 family. |
| Subcellular Location | Nucleus . Cytoplasm . |
| Subunit | SRA1 RNA exists in a ribonucleoprotein complex containing NCOA1. The RNA also forms a complex with PUS1 and RARG in the nucleus. Interacts with AR. {ECO:0000250|UniProtKB:Q6QGW5, ECO:0000250|UniProtKB:Q9HD15, ECO:0000269|PubMed:15327771}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003209 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 257096048 | RefSeq | NP_079567 | 232 | steroid receptor RNA activator 1 isoform a |
Identical Sequences to LMP003209 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:257096048 | SwissProt | Q80VJ2.3 | 232 | RecName: Full=Steroid receptor RNA activator 1; AltName: Full=Steroid receptor RNA activator protein; Short=SRAP [Mus musculus] |
Related Sequences to LMP003209 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:257096048 | DBBJ | BAB24943.1 | 220 | unnamed protein product [Mus musculus] |
| GI:257096048 | DBBJ | BAB26893.1 | 220 | unnamed protein product [Mus musculus] |
| GI:257096048 | DBBJ | BAE32451.1 | 220 | unnamed protein product [Mus musculus] |
| GI:257096048 | GenBank | AAH48362.1 | 220 | Steroid receptor RNA activator 1 [Mus musculus] |
| GI:257096048 | GenBank | EDK97167.1 | 220 | steroid receptor RNA activator 1 [Mus musculus] |
| GI:257096048 | GenBank | EDL76302.1 | 232 | steroid receptor RNA activator 1, isoform CRA_a [Rattus norvegicus] |