Gene/Proteome Database (LMPD)
LMPD ID
LMP003412
Gene ID
Species
Homo sapiens (Human)
Gene Name
dehydrogenase/reductase (SDR family) member 4
Gene Symbol
Synonyms
CR; NRDR; PHCR; PSCD; SCAD-SRL; SDR-SRL; SDR25C1; SDR25C2
Alternate Names
dehydrogenase/reductase SDR family member 4; peroxisomal short-chain alcohol dehydrogenase; NADPH-dependent retinol dehydrogenase/reductase; short-chain dehydrogenase/reductase family member 4; dehydrogenase/reductase (SDR family) member 4 like 2A; short chain dehydrogenase/reductase family 25C, member 1; short chain dehydrogenase/reductase family 25C, member 2; NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase
Chromosome
14
Map Location
14q11.2
EC Number
1.1.1.184
Proteins
| dehydrogenase/reductase SDR family member 4 isoform 1 | |
|---|---|
| Refseq ID | NP_066284 |
| Protein GI | 32483357 |
| UniProt ID | Q9BTZ2 |
| mRNA ID | NM_021004 |
| Length | 278 |
| RefSeq Status | VALIDATED |
| MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL | |
| dehydrogenase/reductase SDR family member 4 isoform 2 | |
|---|---|
| Refseq ID | NP_001269916 |
| Protein GI | 545479056 |
| UniProt ID | Q9BTZ2 |
| mRNA ID | NM_001282987 |
| Length | 188 |
| RefSeq Status | VALIDATED |
| MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKRRLSGDRVFHSSLQSISSLDGQGKRGKHERNPADKKVRRARGLCWHRVFPVL | |
| dehydrogenase/reductase SDR family member 4 isoform 3 | |
|---|---|
| Refseq ID | NP_001269917 |
| Protein GI | 545478136 |
| UniProt ID | Q9BTZ2 |
| mRNA ID | NM_001282988 |
| Length | 244 |
| RefSeq Status | VALIDATED |
| MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL | |
| dehydrogenase/reductase SDR family member 4 isoform 4 | |
|---|---|
| Refseq ID | NP_001269918 |
| Protein GI | 545478136 |
| UniProt ID | Q9BTZ2 |
| mRNA ID | NM_001282989 |
| Length | 244 |
| RefSeq Status | VALIDATED |
| MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL | |
| dehydrogenase/reductase SDR family member 4 isoform 5 | |
|---|---|
| Refseq ID | NP_001269919 |
| Protein GI | 545478136 |
| UniProt ID | Q9BTZ2 |
| mRNA ID | NM_001282990 |
| Length | 244 |
| RefSeq Status | VALIDATED |
| MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL | |
| dehydrogenase/reductase SDR family member 4 isoform 6 | |
|---|---|
| Refseq ID | NP_001269920 |
| Protein GI | 545478136 |
| UniProt ID | Q9BTZ2 |
| mRNA ID | NM_001282991 |
| Length | 244 |
| RefSeq Status | VALIDATED |
| MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL | |
Gene Information
Entrez Gene ID
Gene Name
dehydrogenase/reductase (SDR family) member 4
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0043231 | IDA:HPA | C | intracellular membrane-bounded organelle |
| GO:0005739 | ISS:UniProtKB | C | mitochondrion |
| GO:0031965 | IDA:HPA | C | nuclear membrane |
| GO:0005634 | IDA:UniProtKB | C | nucleus |
| GO:0005778 | IDA:UniProtKB | C | peroxisomal membrane |
| GO:0005777 | IDA:UniProtKB | C | peroxisome |
| GO:0000253 | IDA:UniProtKB | F | 3-keto sterol reductase activity |
| GO:0018455 | IDA:UniProtKB | F | alcohol dehydrogenase [NAD(P)+] activity |
| GO:0004090 | IDA:UniProtKB | F | carbonyl reductase (NADPH) activity |
| GO:0016655 | IDA:UniProtKB | F | oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor |
| GO:0005102 | IPI:UniProtKB | F | receptor binding |
| GO:0006066 | IDA:UniProtKB | P | alcohol metabolic process |
| GO:0042180 | IDA:UniProtKB | P | cellular ketone metabolic process |
| GO:0055114 | IDA:UniProtKB | P | oxidation-reduction process |
| GO:0051262 | IDA:UniProtKB | P | protein tetramerization |
| GO:0008202 | IDA:UniProtKB | P | steroid metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
dehydrogenase/reductase (SDR family) member 4
Protein Entry
DHRS4_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=8; Name=1; Synonyms=SDR-SRL3; IsoId=Q9BTZ2-1; Sequence=Displayed; Name=2; Synonyms=SDR-SRL1; IsoId=Q9BTZ2-2; Sequence=VSP_008586; Name=3; Synonyms=SDR-SRL2; IsoId=Q9BTZ2-3; Sequence=VSP_008585; Name=4; Synonyms=NRDRB1; IsoId=Q9BTZ2-4; Sequence=VSP_031436; Name=5; Synonyms=NRDRB2; IsoId=Q9BTZ2-5; Sequence=VSP_031436, VSP_031438; Note=Contains a phosphoserine at position 140.; Name=6; Synonyms=DHRS4L2, NRDRA1; IsoId=Q9BTZ2-6; Sequence=VSP_031435; Name=7; Synonyms=NRDRA2; IsoId=Q9BTZ2-7; Sequence=VSP_031437, VSP_031439; Note=Mainly localized in the nucleus.; Name=8; Synonyms=NRDRB1; IsoId=Q9BTZ2-8; Sequence=VSP_044947, VSP_031436; Note=Enhanced dicarbonyl reductase activity. high expression in liver.; |
| Catalytic Activity | R-CHOH-R' + NADP(+) = R-CO-R' + NADPH. |
| Function | Reduces all-trans-retinal and 9-cis retinal. Can also catalyze the oxidation of all-trans-retinol with NADP as co- factor, but with much lower efficiency. Reduces alkyl phenyl ketones and alpha-dicarbonyl compounds with aromatic rings, such as pyrimidine-4-aldehyde, 3-benzoylpyridine, 4-benzoylpyridine, menadione and 4-hexanoylpyridine. Has no activity towards aliphatic aldehydes and ketones (By similarity). |
| Miscellaneous | Inhibited by kaempferol, quercetin, genistein and myristic acid. |
| Sequence Caution | Sequence=AAD02292.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=AAL61824.2; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=BAB18775.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=BAG37057.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Subcellular Location | Isoform 7: Nucleus . |
| Subcellular Location | Peroxisome . Note=Isoform 1 is peroxisomal, while isoform 4 is not. |
| Subunit | Homotetramer. |
| Tissue Specificity | Isoform 1 is predominantly expressed in normal cervix (at protein level). Isoform 4 is expressed in some neoplastic cervical tissues, but not in normal cervix (at protein level). Isoform 5 and isoform 6 are expressed in a few neoplastic cervical tissues. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003412 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 32483357 | RefSeq | NP_066284 | 278 | dehydrogenase/reductase SDR family member 4 isoform 1 |
| 545479056 | RefSeq | NP_001269916 | 188 | dehydrogenase/reductase SDR family member 4 isoform 2 |
| 545478136 | RefSeq | NP_001269917 | 244 | dehydrogenase/reductase SDR family member 4 isoform 3 |
| 545478136 | RefSeq | NP_001269918 | 244 | dehydrogenase/reductase SDR family member 4 isoform 4 |
| 545478136 | RefSeq | NP_001269919 | 244 | dehydrogenase/reductase SDR family member 4 isoform 5 |
| 545478136 | RefSeq | NP_001269920 | 244 | dehydrogenase/reductase SDR family member 4 isoform 6 |
Identical Sequences to LMP003412 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:545479056 | GenBank | AAT70757.1 | 188 | NADP(H)-dependent retinol dehydrogenase A2 isoform [Homo sapiens] |
| GI:545478136 | GenBank | ABC61320.1 | 244 | NADP(H)-dependent retinol dehydrogenase/reductase B1 isoform [Homo sapiens] |
| GI:545478136 | GenBank | ABC61320.1 | 244 | NADP(H)-dependent retinol dehydrogenase/reductase B1 isoform [Homo sapiens] |
| GI:545478136 | GenBank | ABC61320.1 | 244 | NADP(H)-dependent retinol dehydrogenase/reductase B1 isoform [Homo sapiens] |
| GI:545478136 | GenBank | ABC61320.1 | 244 | NADP(H)-dependent retinol dehydrogenase/reductase B1 isoform [Homo sapiens] |
| GI:32483357 | GenBank | ABJ37883.1 | 278 | Sequence 2 from patent US 7101984 |
| GI:32483357 | GenBank | ADC20521.1 | 278 | Sequence 1005 from patent US 7638288 |
| GI:32483357 | GenBank | AFL44401.1 | 278 | Sequence 1 from patent US 8183004 |
| GI:32483357 | GenBank | AGD01482.1 | 278 | Sequence 1005 from patent US 8338124 |
| GI:32483357 | GenBank | AHD74517.1 | 278 | Sequence 14534 from patent US 8586006 |
| GI:32483357 | SwissProt | Q9BTZ2.3 | 278 | RecName: Full=Dehydrogenase/reductase SDR family member 4; AltName: Full=NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase; Short=CR; Short=PHCR; AltName: Full=NADPH-dependent retinol dehydrogenase/reductase; Short=NRDR; Short=humNRDR; AltName: Full=Peroxisomal short-chain alcohol dehydrogenase; Short=PSCD; AltName: Full=SCAD-SRL; AltName: Full=Short-chain dehydrogenase/reductase family member 4 [Homo sapiens] |
Related Sequences to LMP003412 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:32483357 | DBBJ | BAA91953.1 | 278 | unnamed protein product [Homo sapiens] |
| GI:32483357 | EMBL | CAE89847.1 | 278 | unnamed protein product [Homo sapiens] |
| GI:32483357 | EMBL | CAH90549.1 | 278 | hypothetical protein [Pongo abelii] |
| GI:545478136 | GenBank | AAQ89001.1 | 278 | SCAD-SRL [Homo sapiens] |
| GI:545478136 | GenBank | AAQ89001.1 | 278 | SCAD-SRL [Homo sapiens] |
| GI:545478136 | GenBank | AAQ89001.1 | 278 | SCAD-SRL [Homo sapiens] |
| GI:545478136 | GenBank | AAQ89001.1 | 278 | SCAD-SRL [Homo sapiens] |
| GI:545478136 | RefSeq | XP_001109951.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 2 [Macaca mulatta] |
| GI:545478136 | RefSeq | XP_001109951.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 2 [Macaca mulatta] |
| GI:545478136 | RefSeq | XP_001109951.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 2 [Macaca mulatta] |
| GI:545478136 | RefSeq | XP_001109951.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 2 [Macaca mulatta] |
| GI:545478136 | RefSeq | XP_001164466.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4 isoform X2 [Pan troglodytes] |
| GI:545478136 | RefSeq | XP_001164466.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4 isoform X2 [Pan troglodytes] |
| GI:545478136 | RefSeq | XP_001164466.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4 isoform X2 [Pan troglodytes] |
| GI:545478136 | RefSeq | XP_001164466.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4 isoform X2 [Pan troglodytes] |
| GI:32483357 | RefSeq | NP_001125292.1 | 278 | dehydrogenase/reductase SDR family member 4 [Pongo abelii] |
| GI:545478136 | RefSeq | XP_003260708.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 2 [Nomascus leucogenys] |
| GI:545478136 | RefSeq | XP_003260708.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 2 [Nomascus leucogenys] |
| GI:545478136 | RefSeq | XP_003260708.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 2 [Nomascus leucogenys] |
| GI:545478136 | RefSeq | XP_003260708.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 2 [Nomascus leucogenys] |
| GI:545478136 | RefSeq | XP_004055026.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 1 [Gorilla gorilla gorilla] |
| GI:545478136 | RefSeq | XP_004055026.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 1 [Gorilla gorilla gorilla] |
| GI:545478136 | RefSeq | XP_004055026.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 1 [Gorilla gorilla gorilla] |
| GI:545478136 | RefSeq | XP_004055026.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform 1 [Gorilla gorilla gorilla] |
| GI:545478136 | RefSeq | XP_005560970.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform X2 [Macaca fascicularis] |
| GI:545478136 | RefSeq | XP_005560970.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform X2 [Macaca fascicularis] |
| GI:545478136 | RefSeq | XP_005560970.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform X2 [Macaca fascicularis] |
| GI:545478136 | RefSeq | XP_005560970.1 | 244 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform X2 [Macaca fascicularis] |
| GI:545479056 | RefSeq | XP_005859671.1 | 189 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform X5 [Myotis brandtii] |
| GI:545479056 | RefSeq | XP_006102339.1 | 189 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform X5 [Myotis lucifugus] |
| GI:545479056 | RefSeq | XP_006760932.1 | 284 | PREDICTED: dehydrogenase/reductase SDR family member 4-like isoform X2 [Myotis davidii] |
| GI:545479056 | RefSeq | XP_007989105.1 | 188 | PREDICTED: dehydrogenase/reductase SDR family member 4 isoform X5 [Chlorocebus sabaeus] |
| GI:545479056 | RefSeq | XP_008156706.1 | 189 | PREDICTED: dehydrogenase/reductase SDR family member 4 isoform X5 [Eptesicus fuscus] |
| GI:32483357 | RefSeq | XP_009247234.1 | 278 | PREDICTED: dehydrogenase/reductase SDR family member 4 isoform X1 [Pongo abelii] |
| GI:545479056 | RefSeq | XP_009425813.1 | 188 | PREDICTED: dehydrogenase/reductase SDR family member 4 isoform X5 [Pan troglodytes] |
| GI:32483357 | SwissProt | Q5RCF8.3 | 278 | RecName: Full=Dehydrogenase/reductase SDR family member 4; AltName: Full=NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase; Short=CR; Short=PHCR; AltName: Full=NADPH-dependent retinol dehydrogenase/reductase; Short=NDRD; AltName: Full=Peroxisomal short-chain alcohol dehydrogenase; Short=PSCD [Pongo abelii] |