Gene/Proteome Database (LMPD)

LMPD ID
LMP003467
Gene ID
218121
Species
Mus musculus (Mouse)
Gene Name
membrane bound O-acyltransferase domain containing 1
Gene Symbol
Mboat1
Synonyms
9130215M02Rik; BC023845; LPEAT1; Moact1; Oact1
Alternate Names
lysophospholipid acyltransferase 1; LPEAT; LPSAT; LPLAT 1; LPE acyltransferase 1; lyso-PE acyltransferase; lyso-PS acyltransferase; lysophosphatidylserine acyltransferase; 1-acylglycerophosphoserine O-acyltransferase; lysophosphatidylethanolamine acyltransferase; O-acyltransferase domain-containing protein 1; 1-acylglycerophosphoethanolamine O-acyltransferase; membrane bound O-acyl transferase family, member 1; O-acyltransferase (membrane bound) domain containing 1; membrane-bound O-acyltransferase domain-containing protein 1
Chromosome
13
Map Location
13 A3.2|13
EC Number
2.3.1.-

Proteins

lysophospholipid acyltransferase 1
Refseq ID NP_705774
Protein GI 23956314
UniProt ID Q8BH98
mRNA ID NM_153546
Length 492
RefSeq Status PROVISIONAL
MAARPPASLSYRTTGSTCLHPLSQLLGIPLDQVNFVACQLFALSAAFWFRIYLHPGKASPEVRHTLATILGIYFVVFCFGWYAVHLFVLVLMCYGVMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRKAEDLSAEQHRLAVKAKPSLLEYLSYHLNFMSVIAGPCNNFKDYVAFIEGRHIHMKLLEVNWTQRGFQSLPEPSPMGAVIQKLCVTLMSLLLFLTLSKSFPVTFLIDDWFVHKANFLSRLWYLYVVMQAAKPKYYFAWTLADAVHNAAGFGFNGMDTDGKSRWDLLSNLNIWKIETATSFKMYLENWNIQTSTWLKCVCYERVPWYPTVLTFLLSALWHGVYPGYYFTFLTGVPVTLAARAVRNNYRHHFLSSKARKIAYDVVTWAVTQLAVSYTAAPFVMLAVEPTISLYKSVFFFLHIICLLIILFLPIKPHQPQRQSRSPNSVKKKAD

Gene Information

Entrez Gene ID
218121
Gene Name
membrane bound O-acyltransferase domain containing 1
Gene Symbol
Mboat1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016747 IEA:UniProtKB-EC F transferase activity, transferring acyl groups other than amino-acyl groups
GO:0008654 IEA:UniProtKB-KW P phospholipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00561 Glycerolipid metabolism
mmu00564 Glycerophospholipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5893980 Acyl chain remodelling of PS

Domain Information

InterPro Annotations

Accession Description
IPR004299 Membrane bound O-acyl transferase, MBOAT

UniProt Annotations

Entry Information

Gene Name
membrane bound O-acyltransferase domain containing 1
Protein Entry
MBOA1_MOUSE
UniProt ID
Q8BH98
Species
Mouse

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=4.7 uM for oleoyl-CoA (in the presence of LPE C18:1 as cosubstrate) {ECO:0000269|PubMed:18287005}; KM=3.9 uM for oleoyl-CoA (in the presence of LPS C18:1 as cosubstrate) {ECO:0000269|PubMed:18287005}; KM=7.75 uM for LPE C18:1 (in the presence of oleoyl-CoA as cosubstrate) {ECO:0000269|PubMed:18287005}; KM=2.25 uM for LPS C18:1 (in the presence of oleoyl-CoA as cosubstrate) {ECO:0000269|PubMed:18287005}; Vmax=9.125 nmol/min/mg enzyme with oleoyl-CoA and LPE C18:1 as substrates {ECO:0000269|PubMed:18287005}; Vmax=4.7 nmol/min/mg enzyme with oleoyl-CoA and LPS C18:1 as substrates {ECO:0000269|PubMed:18287005};
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycero-3- phosphatidylserine = CoA + 1,2-diacyl-sn-glycero-3- phosphatidylserine.
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycero-3- phosphoethanolamine = CoA + 1,2-diacyl-sn-glycero-3- phosphoethanolamine.
Function Acyltransferase which mediates the conversion of lysophosphatidylethanolamine (1-acyl-sn-glycero-3- phosphoethanolamine or LPE) into phosphatidylethanolamine (1,2- diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity). Catalyzes also the acylation of lysophosphatidylserine (1-acyl-2- hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Prefers oleoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. {ECO:0000269|PubMed:18287005}.
Pathway Lipid metabolism; phospholipid metabolism.
Similarity Belongs to the membrane-bound acyltransferase family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. Endoplasmic reticulum {ECO:0000269|PubMed:18287005}.
Tissue Specificity Highly expressed in stomach, epididymis, and colon. {ECO:0000269|PubMed:18287005}.

Identical and Related Proteins

Unique RefSeq proteins for LMP003467 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
23956314 RefSeq NP_705774 492 lysophospholipid acyltransferase 1

Identical Sequences to LMP003467 proteins

Reference Database Accession Length Protein Name
GI:23956314 DBBJ BAE27587.1 492 unnamed protein product [Mus musculus]
GI:23956314 DBBJ BAF93901.1 492 lysophospholipid acyltransferase [Mus musculus]
GI:23956314 DBBJ BAG12121.1 492 LPE acyltransferase 1 [Mus musculus]
GI:23956314 GenBank EDL32389.1 492 membrane bound O-acyltransferase domain containing 1, isoform CRA_a [Mus musculus]
GI:23956314 GenBank EDL32390.1 492 membrane bound O-acyltransferase domain containing 1, isoform CRA_a [Mus musculus]
GI:23956314 SwissProt Q8BH98.1 492 RecName: Full=Lysophospholipid acyltransferase 1; Short=LPLAT 1; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; AltName: Full=1-acylglycerophosphoserine O-acyltransferase; AltName: Full=Lysophosphatidylethanolamine acyltransferase; Short=LPEAT; Short=Lyso-PE acyltransferase; AltName: Full=Lysophosphatidylserine acyltransferase; Short=LPSAT; Short=Lyso-PS acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 1; Short=O-acyltransferase domain-containing protein 1 [Mus musculus]

Related Sequences to LMP003467 proteins

Reference Database Accession Length Protein Name
GI:23956314 GenBank AAH24653.1 492 Mboat1 protein [Mus musculus]
GI:23956314 GenBank ADM04704.1 492 Sequence 42 from patent US 7732155
GI:23956314 GenBank ADM04724.1 492 Sequence 62 from patent US 7732155
GI:23956314 GenBank AGM70842.1 492 Sequence 42 from patent US 8383886
GI:23956314 GenBank AGM70862.1 492 Sequence 62 from patent US 8383886
GI:23956314 RefSeq NP_001102590.1 492 lysophospholipid acyltransferase 1 [Rattus norvegicus]