Gene/Proteome Database (LMPD)
LMPD ID
LMP003467
Gene ID
Species
Mus musculus (Mouse)
Gene Name
membrane bound O-acyltransferase domain containing 1
Gene Symbol
Synonyms
9130215M02Rik; BC023845; LPEAT1; Moact1; Oact1
Alternate Names
lysophospholipid acyltransferase 1; LPEAT; LPSAT; LPLAT 1; LPE acyltransferase 1; lyso-PE acyltransferase; lyso-PS acyltransferase; lysophosphatidylserine acyltransferase; 1-acylglycerophosphoserine O-acyltransferase; lysophosphatidylethanolamine acyltransferase; O-acyltransferase domain-containing protein 1; 1-acylglycerophosphoethanolamine O-acyltransferase; membrane bound O-acyl transferase family, member 1; O-acyltransferase (membrane bound) domain containing 1; membrane-bound O-acyltransferase domain-containing protein 1
Chromosome
13
Map Location
13 A3.2|13
EC Number
2.3.1.-
Proteins
| lysophospholipid acyltransferase 1 | |
|---|---|
| Refseq ID | NP_705774 |
| Protein GI | 23956314 |
| UniProt ID | Q8BH98 |
| mRNA ID | NM_153546 |
| Length | 492 |
| RefSeq Status | PROVISIONAL |
| MAARPPASLSYRTTGSTCLHPLSQLLGIPLDQVNFVACQLFALSAAFWFRIYLHPGKASPEVRHTLATILGIYFVVFCFGWYAVHLFVLVLMCYGVMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRKAEDLSAEQHRLAVKAKPSLLEYLSYHLNFMSVIAGPCNNFKDYVAFIEGRHIHMKLLEVNWTQRGFQSLPEPSPMGAVIQKLCVTLMSLLLFLTLSKSFPVTFLIDDWFVHKANFLSRLWYLYVVMQAAKPKYYFAWTLADAVHNAAGFGFNGMDTDGKSRWDLLSNLNIWKIETATSFKMYLENWNIQTSTWLKCVCYERVPWYPTVLTFLLSALWHGVYPGYYFTFLTGVPVTLAARAVRNNYRHHFLSSKARKIAYDVVTWAVTQLAVSYTAAPFVMLAVEPTISLYKSVFFFLHIICLLIILFLPIKPHQPQRQSRSPNSVKKKAD | |
Gene Information
Entrez Gene ID
Gene Name
membrane bound O-acyltransferase domain containing 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016747 | IEA:UniProtKB-EC | F | transferase activity, transferring acyl groups other than amino-acyl groups |
| GO:0008654 | IEA:UniProtKB-KW | P | phospholipid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu00561 | Glycerolipid metabolism |
| mmu00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5893980 | Acyl chain remodelling of PS |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR004299 | Membrane bound O-acyl transferase, MBOAT |
UniProt Annotations
Entry Information
Gene Name
membrane bound O-acyltransferase domain containing 1
Protein Entry
MBOA1_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=4.7 uM for oleoyl-CoA (in the presence of LPE C18:1 as cosubstrate) {ECO:0000269|PubMed:18287005}; KM=3.9 uM for oleoyl-CoA (in the presence of LPS C18:1 as cosubstrate) {ECO:0000269|PubMed:18287005}; KM=7.75 uM for LPE C18:1 (in the presence of oleoyl-CoA as cosubstrate) {ECO:0000269|PubMed:18287005}; KM=2.25 uM for LPS C18:1 (in the presence of oleoyl-CoA as cosubstrate) {ECO:0000269|PubMed:18287005}; Vmax=9.125 nmol/min/mg enzyme with oleoyl-CoA and LPE C18:1 as substrates {ECO:0000269|PubMed:18287005}; Vmax=4.7 nmol/min/mg enzyme with oleoyl-CoA and LPS C18:1 as substrates {ECO:0000269|PubMed:18287005}; |
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycero-3- phosphatidylserine = CoA + 1,2-diacyl-sn-glycero-3- phosphatidylserine. |
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycero-3- phosphoethanolamine = CoA + 1,2-diacyl-sn-glycero-3- phosphoethanolamine. |
| Function | Acyltransferase which mediates the conversion of lysophosphatidylethanolamine (1-acyl-sn-glycero-3- phosphoethanolamine or LPE) into phosphatidylethanolamine (1,2- diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity). Catalyzes also the acylation of lysophosphatidylserine (1-acyl-2- hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Prefers oleoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. {ECO:0000269|PubMed:18287005}. |
| Pathway | Lipid metabolism; phospholipid metabolism. |
| Similarity | Belongs to the membrane-bound acyltransferase family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. Endoplasmic reticulum {ECO:0000269|PubMed:18287005}. |
| Tissue Specificity | Highly expressed in stomach, epididymis, and colon. {ECO:0000269|PubMed:18287005}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003467 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 23956314 | RefSeq | NP_705774 | 492 | lysophospholipid acyltransferase 1 |
Identical Sequences to LMP003467 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:23956314 | DBBJ | BAE27587.1 | 492 | unnamed protein product [Mus musculus] |
| GI:23956314 | DBBJ | BAF93901.1 | 492 | lysophospholipid acyltransferase [Mus musculus] |
| GI:23956314 | DBBJ | BAG12121.1 | 492 | LPE acyltransferase 1 [Mus musculus] |
| GI:23956314 | GenBank | EDL32389.1 | 492 | membrane bound O-acyltransferase domain containing 1, isoform CRA_a [Mus musculus] |
| GI:23956314 | GenBank | EDL32390.1 | 492 | membrane bound O-acyltransferase domain containing 1, isoform CRA_a [Mus musculus] |
| GI:23956314 | SwissProt | Q8BH98.1 | 492 | RecName: Full=Lysophospholipid acyltransferase 1; Short=LPLAT 1; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; AltName: Full=1-acylglycerophosphoserine O-acyltransferase; AltName: Full=Lysophosphatidylethanolamine acyltransferase; Short=LPEAT; Short=Lyso-PE acyltransferase; AltName: Full=Lysophosphatidylserine acyltransferase; Short=LPSAT; Short=Lyso-PS acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 1; Short=O-acyltransferase domain-containing protein 1 [Mus musculus] |
Related Sequences to LMP003467 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:23956314 | GenBank | AAH24653.1 | 492 | Mboat1 protein [Mus musculus] |
| GI:23956314 | GenBank | ADM04704.1 | 492 | Sequence 42 from patent US 7732155 |
| GI:23956314 | GenBank | ADM04724.1 | 492 | Sequence 62 from patent US 7732155 |
| GI:23956314 | GenBank | AGM70842.1 | 492 | Sequence 42 from patent US 8383886 |
| GI:23956314 | GenBank | AGM70862.1 | 492 | Sequence 62 from patent US 8383886 |
| GI:23956314 | RefSeq | NP_001102590.1 | 492 | lysophospholipid acyltransferase 1 [Rattus norvegicus] |